Recombinant Full Length Salmonella Typhimurium Trk System Potassium Uptake Protein Trkh(Trkh) Protein, His-Tagged
Cat.No. : | RFL11580SF |
Product Overview : | Recombinant Full Length Salmonella typhimurium Trk system potassium uptake protein trkH(trkH) Protein (Q9L6L2) (1-483aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhimurium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-483) |
Form : | Lyophilized powder |
AA Sequence : | MHFRAITRIVGLLVILFSGTMILPGLVALIYRDGAGRAFTQTFFVALAIGSILWWPNRRE KGELKSREGFLIVVLFWTVLGSVGALPFIFSESPNLTITDAFFESFSGLTTTGATTLVGL DSLPHAILFYRQMLQWFGGMGIIVLAVAILPILGVGGMQLYRAEMPGPLKDNKMRPRIAE TAKTLWLIYVLLTVACALALWFAGMPAFDAIGHSFSTIAIGGFSTHDASVGYFDSPTINT IIAIFLLISGCNYGLHFSLLSGRSLKVYWRDPEFRMFIGVQLTLVVICTLVLWFHNIYDS ALTTLNQAFFQVVSMATTAGFTTDSIARWPLFLPVLLLCSAFIGGCAGSTGGGLKVIRIL LLFKQGNRELKRLVHPNAVYSIKLGNRALPERILEAVWGFFSAYALVFIVSMLAIIATGV DDFSAFASVVATLNNLGPGLGVVADNFASMNPVAKWILIANMLFGRLEVFTLLVLFTPTF WRE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | trkH |
Synonyms | trkH; STM3986; STMD1.3; Trk system potassium uptake protein TrkH |
UniProt ID | Q9L6L2 |
◆ Recombinant Proteins | ||
Ocm-4444R | Recombinant Rat Ocm protein, His-tagged | +Inquiry |
RFL29870BF | Recombinant Full Length Bacillus Subtilis Probable Amino-Acid Permease Protein Yxen(Yxen) Protein, His-Tagged | +Inquiry |
CYBASC3-4131M | Recombinant Mouse CYBASC3 Protein | +Inquiry |
HSD17B3-1464H | Recombinant Human HSD17B3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CD80-0268H | Recombinant Human CD80 protein, His-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
GLDH-213B | Active Native Bovine Glutamate Dehydrogenase | +Inquiry |
Plg-1897R | Native Rat Plasminogen | +Inquiry |
FGA-80H | Active Native Human Fibrinogen (plasminogen depleted) | +Inquiry |
CA 19-9-378H | Active Native Human Cancer Antigen 19-9 | +Inquiry |
Lectin-1804L | Active Native Lycopersicon Esculentum Lectin Protein, DyLight 649 labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
Colon-795G | Guinea Pig Colon Membrane Lysate, Total Protein | +Inquiry |
ST6GAL1-1760MCL | Recombinant Mouse ST6GAL1 cell lysate | +Inquiry |
PGPEP1-1341HCL | Recombinant Human PGPEP1 cell lysate | +Inquiry |
IGFBP6-1902HCL | Recombinant Human IGFBP6 cell lysate | +Inquiry |
C13orf15-8305HCL | Recombinant Human C13orf15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All trkH Products
Required fields are marked with *
My Review for All trkH Products
Required fields are marked with *
0
Inquiry Basket