Recombinant Full Length Salmonella Typhimurium Secretion System Apparatus Protein Ssav(Ssav) Protein, His-Tagged
Cat.No. : | RFL31355SF |
Product Overview : | Recombinant Full Length Salmonella typhimurium Secretion system apparatus protein SsaV(ssaV) Protein (D0ZWU0) (1-681aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhimurium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-681) |
Form : | Lyophilized powder |
AA Sequence : | MRSWLGEGVRAQQWLSVCAGRQDMVLATVLLIAIVMMLLPLPTWMVDILITINLMFSVIL LLIAIYLSDPLDLSVFPSLLLITTLYRLSLTISTSRLVLLQHNAGNIVDAFGKFVVGGNL TVGLVVFTIITIVQFIVITKGIERVAEVSARFSLDGMPGKQMSIDGDLRAGVIDADHART LRQHVQQESRFLGAMDGAMKFVKGDTIAGIIVVLVNIIGGIIIAIVQYDMSMSEAVHTYS VLSIGDGLCGQIPSLLISLSAGIIVTRVPGEKRQNLATELSSQIARQPQSLILTAVVLML LALIPGFPFITLAFFSALLALPIILIRRKKSVVSANGVEAPEKDSMVPGACPLILRLSPT LHSADLIRDIDAMRWFLFEDTGVPLPEVNIEVLPEPTEKLTVLLYQEPVFSLSIPAQADY LLIGADASVVGDSQTLPNGMGQICWLTKDMAHKAQGFGLDVFAGSQRISALLKCVLLRHM GEFIGVQETRYLMNAMEKNYSELVKELQRQLPINKIAETLQRLVSERVSIRDLRLIFGTL IDWAPREKDVLMLTEYVRIALRRHILRRLNPEGKPLPILRIGEGIENLVRESIRQTAMGT YTALSSRHKTQILQLIEQALKQSAKLFIVTSVDTRRFLRKITEATLFDVPILSWQELGEE SLIQVVESIDLSEEELADNEE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ssaV |
Synonyms | ssaV; STM14_1710; Secretion system apparatus protein SsaV |
UniProt ID | D0ZWU0 |
◆ Recombinant Proteins | ||
SCNM1-PS-7939M | Recombinant Mouse SCNM1-PS Protein, His (Fc)-Avi-tagged | +Inquiry |
Tnfrsf13c-217M | Recombinant Mouse Tnfrsf13c protein, His/S-tagged | +Inquiry |
CNTNAP5-4938H | Recombinant Human CNTNAP5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CETP-3291HF | Recombinant Full Length Human CETP Protein, GST-tagged | +Inquiry |
TAAR9-16365M | Recombinant Mouse TAAR9 Protein | +Inquiry |
◆ Native Proteins | ||
COL1A1-23M | Native Mouse Collagen I Protein | +Inquiry |
PLD-16C | Active Native cabbage Phospholipase D, Type IV | +Inquiry |
MUC2-28P | Native Pig Mucin 2 (MUC2) Protein | +Inquiry |
COL2A1-1647H | Native Human COL2A1 Protein | +Inquiry |
SAP6-91 | Active Native Saponaria Officinalis SAP6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF3A-6664HCL | Recombinant Human EIF3A 293 Cell Lysate | +Inquiry |
C10ORF54-1249HCL | Recombinant Human C10ORF54 cell lysate | +Inquiry |
CCDC96-165HCL | Recombinant Human CCDC96 lysate | +Inquiry |
NUP155-3632HCL | Recombinant Human NUP155 293 Cell Lysate | +Inquiry |
TBX5-1198HCL | Recombinant Human TBX5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ssaV Products
Required fields are marked with *
My Review for All ssaV Products
Required fields are marked with *
0
Inquiry Basket