Recombinant Full Length Salmonella Schwarzengrund Lipoprotein Signal Peptidase(Lspa) Protein, His-Tagged
Cat.No. : | RFL12989SF |
Product Overview : | Recombinant Full Length Salmonella schwarzengrund Lipoprotein signal peptidase(lspA) Protein (B4TWN7) (1-166aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella schwarzengrund |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-166) |
Form : | Lyophilized powder |
AA Sequence : | MSKPLCSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVGLFPSLNLHYARNYGAAFSF LADSGGWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGF VVDMIDFYVGDWHFATFNLADSAICIGAALIVLEGFLPKPTAKEQA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lspA |
Synonyms | lspA; SeSA_A0051; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II |
UniProt ID | B4TWN7 |
◆ Recombinant Proteins | ||
SYK-030H | Recombinant Human SYK Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
PRPF40B-3915H | Recombinant Human PRPF40B Protein, His (Fc)-Avi-tagged | +Inquiry |
SCP2-3711H | Recombinant Human SCP2 protein, His-tagged | +Inquiry |
BIN1-983R | Recombinant Rat BIN1 Protein | +Inquiry |
ENPP3-112H | Recombinant Human ENPP3 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-129B | Native Bovine milk Immunoglobulin G | +Inquiry |
Lectin-1757C | Active Native Canavalia ensiformis Concanavalin A Protein, Biotinylated | +Inquiry |
LDH-15H | Native Human Lactate Dehydrogenase | +Inquiry |
Lectin-1804L | Active Native Lycopersicon Esculentum Lectin Protein, DyLight 649 labeled | +Inquiry |
Lectin-1811N | Active Native Narcissus Pseudonarcissus Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTC-1049CCL | Recombinant Cynomolgus BTC cell lysate | +Inquiry |
IL11RA-2558MCL | Recombinant Mouse IL11RA cell lysate | +Inquiry |
KLRC1-924MCL | Recombinant Mouse KLRC1 cell lysate | +Inquiry |
COX11-7337HCL | Recombinant Human COX11 293 Cell Lysate | +Inquiry |
RPL13AP17-4337HCL | Recombinant Human MGC34774 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lspA Products
Required fields are marked with *
My Review for All lspA Products
Required fields are marked with *
0
Inquiry Basket