Recombinant Full Length Salmonella Phage P22 Bactoprenol Glucosyl Transferase(Gtrb) Protein, His-Tagged
Cat.No. : | RFL21294SF |
Product Overview : | Recombinant Full Length Salmonella phage P22 Bactoprenol glucosyl transferase(gtrB) Protein (P57022) (1-310aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella phage P22 (Bacteriophage P22) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-310) |
Form : | Lyophilized powder |
AA Sequence : | MKISLVVPVFNEEDTIPIFYKTVREFNELKEYEIEIVFINDGSKDATESIINKIAASDPL VIPLSFTRNFGKEPALFAGLDHATGDAVIPIDVDLQDPIEVIPHLIEKWQAGADMVLAKR SDRSTDGRMKRKTAEWFYKLHNKISNPKIEENVGDFRLMSRAVVENIKQMPERNLFMKGV LSWVGGKTDVVKYARAERVAGDSKFNGWKLWNLALEGITSFSTFPLRIWTYIGLFIAGMS FLYGAWMIIDKLIFGNNVPGYPSLLVSVLFLGGVQLIGIGILGEYIGRIYIETKQRPKYI LKRKGFKSEI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gtrB |
Synonyms | gtrB; Bactoprenol glucosyl transferase |
UniProt ID | P57022 |
◆ Native Proteins | ||
RBP-94H | Native Human Retinol-Binding Protein | +Inquiry |
Collagen-46M | Native Mouse Collagen protein | +Inquiry |
APOA1-26121TH | Native Human APOA1, Protein A-tagged | +Inquiry |
ACPP-8250H | Native Human Prostatic Acid Phosphatase | +Inquiry |
IgA-240B | Native Bovine Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
Fetus-184M | Mouse Fetus (11 Day Fetus) Membrane Lysate | +Inquiry |
SH3BP1-1872HCL | Recombinant Human SH3BP1 293 Cell Lysate | +Inquiry |
AP2A2-8816HCL | Recombinant Human AP2A2 293 Cell Lysate | +Inquiry |
CTBS-7214HCL | Recombinant Human CTBS 293 Cell Lysate | +Inquiry |
WDR12-355HCL | Recombinant Human WDR12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All gtrB Products
Required fields are marked with *
My Review for All gtrB Products
Required fields are marked with *
0
Inquiry Basket