Recombinant Full Length Salmonella Paratyphi C Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL15791SF |
Product Overview : | Recombinant Full Length Salmonella paratyphi C Membrane protein insertase YidC(yidC) Protein (C0Q2L3) (1-548aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella paratyphi C |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-548) |
Form : | Lyophilized powder |
AA Sequence : | MDSQRNLLVIALLFVSFMIWQAWEQDKNPQPQTQQTTQTTTTAAGSAADQGVPASGQGKM ITVKTDVLDLTINTRGGDVEQALLPAYPKELGSNEPFQLLETTPQFIYQAQSGLTGRDGP DNPANGPRPLYNVEKDAFVLADGQNELQVPMTYTDAAGNTFTKTFVFKRGDYAVNVNYSV QNTGEKPLEVSTFGQLKQSVNLPPHRDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIAD NENLNVSSKGGWVAMLQQYFATAWIPRNDGTNNFYTANLGNGIVAIGYKAQPVLVQPGQT SAMTSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLFKLLKWIHSFVGNWGFSIII ITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGDDKQRQSQEMMALYKAEKVNPL GGCFPLIIQMPIFLALYYMLMGSIELRHAPFALWIHDLSAQDPYYILPILMGVTMFFIQK MSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYRGLEKRGL HSREKKKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; SPC_3929; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | C0Q2L3 |
◆ Native Proteins | ||
Lectin-1770D | Active Native Dolichos Biflorus Lectin Protein, Fluorescein labeled | +Inquiry |
CAT-1847B | Active Native Bovine, Catalase | +Inquiry |
VCL tail-900T | Native Turkey VCL tail Protein | +Inquiry |
Lectin-1823P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Biotinylated | +Inquiry |
Hb-117M | Native Mouse Hb | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMC3-2763HCL | Recombinant Human PSMC3 293 Cell Lysate | +Inquiry |
PTPN18-1437HCL | Recombinant Human PTPN18 cell lysate | +Inquiry |
METTL2B-1081HCL | Recombinant Human METTL2B cell lysate | +Inquiry |
ACD-9096HCL | Recombinant Human ACD 293 Cell Lysate | +Inquiry |
DGKE-6957HCL | Recombinant Human DGKE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket