Recombinant Full Length Salmonella Paratyphi B Probable Ubiquinone Biosynthesis Protein Ubib(Ubib) Protein, His-Tagged
Cat.No. : | RFL35852SF |
Product Overview : | Recombinant Full Length Salmonella paratyphi B Probable ubiquinone biosynthesis protein UbiB(ubiB) Protein (A9MY99) (1-546aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella paratyphi B |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-546) |
Form : | Lyophilized powder |
AA Sequence : | MTPGEVRRLYFIIRTFLSYGLDELIPRMRLTLPLRLWRYSLFWMPNRHKDKLLGERLRLA LQELGPVWIKFGQMLSTRRDLFPPQIADQLALLQDKVAPFDGRLAKAQIEEAMGGLPVEA WFDDFDIQPLASASIAQVHTARLKSNGKEVVIKVIRPDILPVIQADLKLIYRLARWVPRL LPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFENSPMLYIPEVYSDYCSQNM MVMERIYGIPVSDVAALEKNGTNMKLLAERGVKVFFTQVFRDSFFHADMHPGNIFVSHEH PENPQYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHVDSGWVPPDTNVEDFE FAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGVGRQLY PQLDLWKTAKPFLESWIKDQVGIPALTRALKEKAPFWVEKMPEIPELVYDSLRQGKYLQH SVDKIARELQVNHVRQSQSRYLLGIGATLLLSGSFLLVNRPEWGLMPGWLMVGGVVVWLV GWRKTR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ubiB |
Synonyms | ubiB; SPAB_04928; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB |
UniProt ID | A9MY99 |
◆ Recombinant Proteins | ||
COX17-1366Z | Recombinant Zebrafish COX17 | +Inquiry |
FTH1-569H | Recombinant Human FTH1 Protein (Met1-Ser183) | +Inquiry |
ZNF124-3816H | Recombinant Human ZNF124, His-tagged | +Inquiry |
RFL32157SF | Recombinant Full Length Synechococcus Sp. Photosystem Q(B) Protein 2(Psba2) Protein, His-Tagged | +Inquiry |
FUT1-4559H | Recombinant Human FUT1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
SAA-256H | Native Human Serum amyloid A Protein | +Inquiry |
Mb-8232R | Native Rat Myoglobin | +Inquiry |
Ferritin-026H | Native Human Ferritin Protein, holo form | +Inquiry |
Pancreas-002H | Human Pancreas Lysate, Total Protein | +Inquiry |
FLNA-873T | Native Turkey FLNA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDZD7-1328HCL | Recombinant Human PDZD7 cell lysate | +Inquiry |
RAD54L-2552HCL | Recombinant Human RAD54L 293 Cell Lysate | +Inquiry |
GPSM3-5764HCL | Recombinant Human GPSM3 293 Cell Lysate | +Inquiry |
FOXRED2-6140HCL | Recombinant Human FOXRED2 293 Cell Lysate | +Inquiry |
Cerebellum-86M | Mouse Cerebellum Tissue Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ubiB Products
Required fields are marked with *
My Review for All ubiB Products
Required fields are marked with *
0
Inquiry Basket