Recombinant Full Length Salmonella Paratyphi A Upf0114 Protein Yqha(Yqha) Protein, His-Tagged
Cat.No. : | RFL27248SF |
Product Overview : | Recombinant Full Length Salmonella paratyphi A UPF0114 protein YqhA(yqhA) Protein (Q5PMS0) (1-164aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella paratyphi A |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-164) |
Form : | Lyophilized powder |
AA Sequence : | MERFLENVMYASRWLLAPVYFGLSLALIALALKFFQEILHVLPNVFALAEADLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISAGKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yqhA |
Synonyms | yqhA; SPA3021; UPF0114 protein YqhA |
UniProt ID | Q5PMS0 |
◆ Recombinant Proteins | ||
Aqp7-821M | Recombinant Mouse Aqp7 Protein, MYC/DDK-tagged | +Inquiry |
ERCC2-2842M | Recombinant Mouse ERCC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Nsf-4506M | Recombinant Mouse Nsf Protein, Myc/DDK-tagged | +Inquiry |
VP1-406V | Recombinant EV71 Capsid VP1 Protein, His-tagged | +Inquiry |
GLI2-6402M | Recombinant Mouse GLI2 Protein | +Inquiry |
◆ Native Proteins | ||
CKB-1177H | Native Human Creatine Kinase, Brain | +Inquiry |
NADS-33 | Active Native NAD synthase | +Inquiry |
GAPDH-126R | Active Native Rabbit GAPDH | +Inquiry |
GLDH-120B | Active Native Bovine Glutamate Dehydrogenase | +Inquiry |
Chitin-001C | Native Crawfish Chitin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATG12-8626HCL | Recombinant Human ATG12 293 Cell Lysate | +Inquiry |
ADAMTS5-9028HCL | Recombinant Human ADAMTS5 293 Cell Lysate | +Inquiry |
NPTN-3727HCL | Recombinant Human NPTN 293 Cell Lysate | +Inquiry |
NUDT16-447HCL | Recombinant Human NUDT16 lysate | +Inquiry |
AHI1-41HCL | Recombinant Human AHI1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yqhA Products
Required fields are marked with *
My Review for All yqhA Products
Required fields are marked with *
0
Inquiry Basket