Recombinant Full Length Salmonella Newport Rhomboid Protease Glpg(Glpg) Protein, His-Tagged
Cat.No. : | RFL36399SF |
Product Overview : | Recombinant Full Length Salmonella newport Rhomboid protease glpG(glpG) Protein (B4SVM1) (1-276aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella newport |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-276) |
Form : | Lyophilized powder |
AA Sequence : | MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDIWLADESQAERVRGELARFIENPG DPRYLAASWQSGQTNSGLRYRRFPFLATLRERAGPVTWIVMLACVLVYIAMSLIGDQTVM VWLAWPFDPVLKFEVWRYFTHIFMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITVI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALLWIVAG WFDWFGMSMANGAHIAGLIVGLAMAFVDTLNARKRT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | glpG |
Synonyms | glpG; SNSL254_A3791; Rhomboid protease GlpG; Intramembrane serine protease |
UniProt ID | B4SVM1 |
◆ Recombinant Proteins | ||
RFL10552PF | Recombinant Full Length Prochlorococcus Marinus Photosystem I Assembly Protein Ycf4(Ycf4) Protein, His-Tagged | +Inquiry |
TNFRSF9-4870R | Recombinant Rhesus monkey TNFRSF9 Protein, His-tagged | +Inquiry |
ILVBL-1316H | Recombinant Human ILVBL Full Length Transmembrane protein, His-tagged | +Inquiry |
PARP15-1531H | Recombinant Human PARP15, His-tagged | +Inquiry |
SEC22A-905C | Recombinant Cynomolgus SEC22A Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
RB5200-3281H | Native Human RB5200 | +Inquiry |
IGHD -21H | Native Human IgD | +Inquiry |
Thrombin-23B | Native Bovine Thrombin | +Inquiry |
HP-199M | Native Monkey Haptoglobin | +Inquiry |
SLC40A1-5335H | Native Human Solute Carrier Family 40 (iron-regulated transporter), Member 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPL29-1539HCL | Recombinant Human RPL29 cell lysate | +Inquiry |
KCT2-906HCL | Recombinant Human KCT2 cell lysate | +Inquiry |
KCNQ3-5018HCL | Recombinant Human KCNQ3 293 Cell Lysate | +Inquiry |
ACPP-1625MCL | Recombinant Mouse ACPP cell lysate | +Inquiry |
CXADR-1102MCL | Recombinant Mouse CXADR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All glpG Products
Required fields are marked with *
My Review for All glpG Products
Required fields are marked with *
0
Inquiry Basket