Recombinant Full Length Salmonella Newport Arginine Exporter Protein Argo(Argo) Protein, His-Tagged
Cat.No. : | RFL14984SF |
Product Overview : | Recombinant Full Length Salmonella newport Arginine exporter protein ArgO(argO) Protein (B4T5G7) (1-211aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella newport |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-211) |
Form : | Lyophilized powder |
AA Sequence : | MISYYFQGFALGAAMILPLGPQNAFVMNQGIRRQYHLMIALLCALSDLVLISAGIFGGSA LLMQSPWLLALVTWGGVAFLLWYGFGALKTAMSSNLELASAEVMKRGRWKIIATMLAVTW LNPHVYLDTFVVLGSLGGQLAMEPKRWFALGTISASFLWFFGLALLAAWLAPRLRTAKAQ RIINILVGVVMWLIAFQLAREGVAHMHALFN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | argO |
Synonyms | argO; SNSL254_A3305; Arginine exporter protein ArgO |
UniProt ID | B4T5G7 |
◆ Native Proteins | ||
CA50-01H | Active Native Human Cancer Antigen 50 protein | +Inquiry |
Ferritin-027H | Native Human Ferritin Protein, apo form | +Inquiry |
Lectin-1855V | Active Native Vicia Villosa Lectin Protein, Agarose bound | +Inquiry |
Hemopexin-035B | Native Bovine Hemopexin Protein | +Inquiry |
Gamma Globulin-72H | Native Human Gamma Globulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2C-591HCL | Recombinant Human UBE2C 293 Cell Lysate | +Inquiry |
TERF2-1146HCL | Recombinant Human TERF2 293 Cell Lysate | +Inquiry |
IPO11-5183HCL | Recombinant Human IPO11 293 Cell Lysate | +Inquiry |
ZNF773-2023HCL | Recombinant Human ZNF773 cell lysate | +Inquiry |
PDF-3338HCL | Recombinant Human PDF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All argO Products
Required fields are marked with *
My Review for All argO Products
Required fields are marked with *
0
Inquiry Basket