Recombinant Full Length Salmonella Enteritidis Pt4 Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL7772SF |
Product Overview : | Recombinant Full Length Salmonella enteritidis PT4 Membrane protein insertase YidC(yidC) Protein (B5QUQ4) (1-548aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella enteritidis PT4 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-548) |
Form : | Lyophilized powder |
AA Sequence : | MDSQRNLLVIALLFVSFMIWQAWEQDKNPQPQTQQTTQTTTTAAGSAADQGVPASGQGKM ITVKTDVLDLTINTRGGDVEQALLPAYPKELGSNEPFQLLETTPQFIYQAQSGLTGRDGP DNPANGPRPLYNVEKDAFVLADGQNELQVPMTYTDAAGNTFTKTFVFKRGDYAVNVNYSV QNAGEKPLEVSTFGQLKQSVNLPPHRDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIAD NENLNVSSKGGWVAMLQQYFATAWIPRNDGTNNFYTANLGNGIVAIGYKAQPVLVQPGQT GAMTSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLFKLLKWIHSFVGNWGFSIII ITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGDDKQRQSQEMMALYKAEKVNPL GGCFPLIIQMPIFLALYYMLMGSIELRHAPFALWIHDLSAQDPYYILPILMGVTMFFIQK MSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYRGLEKRGL HSREKKKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; SEN3659; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | B5QUQ4 |
◆ Native Proteins | ||
PGA-130H | Active Native Human Pepsinogen I | +Inquiry |
Colon-009H | Human Colon Lysate, Total Protein | +Inquiry |
GGT1-371P | Native Porcine Gamma-Glutamyltransferase 1 | +Inquiry |
Pla2-85A | Active Native Apis mellifera Phospholipase A2 | +Inquiry |
Lectin-1716U | Native Ulex europaeus Lectin, Biotin conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-2370HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
VTCN1-1096HCL | Recombinant Human VTCN1 cell lysate | +Inquiry |
MRAP-1131HCL | Recombinant Human MRAP cell lysate | +Inquiry |
CYTH3-1425HCL | Recombinant Human CYTH3 cell lysate | +Inquiry |
CRYAA-7267HCL | Recombinant Human CRYAA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket