Recombinant Full Length Salmonella Choleraesuis Virulence Sensor Histidine Kinase Phoq(Phoq) Protein, His-Tagged
Cat.No. : | RFL20090SF |
Product Overview : | Recombinant Full Length Salmonella choleraesuis Virulence sensor histidine kinase PhoQ(phoQ) Protein (Q57QC4) (1-487aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella choleraesuis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-487) |
Form : | Lyophilized powder |
AA Sequence : | MNKFARHFLPLSLRVRFLLATAGVVLVLSLAYGIVALVGYSVSFDKTTFRLLRGESNLFY TLAKWENNKISVELPENLDMQSPTMTLIYDETGKLLWTQRNIPWLIKSIQPEWLKTNGFH EIETNVDATSTLLSEDHSAQEKLKEVREDDDDAEMTHSVAVNIYPATARMPQLTIVVVDT IPIELKRSYMVWSWFVYVLAANLLLVIPLLWIAAWWSLRPIEALAREVRELEDHHREMLN PETTRELTSLVRNLNQLLKSERERYNKYRTTLTDLTHSLKTPLAVLQSTLRSLRNEKMSV SKAEPVMLEQISRISQQIGYYLHRASMRGSGVLLSRELHPVAPLLDNLISALNKVYQRKG VNISMDISPEISFVGEQNDFVEVMGNVLDNACKYCLEFVEISARQTDDHLHIFVEDDGPG IPHSKRSLVFDRGQRADTLRPGQGVGLAVAREITEQYAGQIIASDSLLGGARMEVVFGRQ HPTQKEE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | phoQ |
Synonyms | phoQ; SCH_1181; Virulence sensor histidine kinase PhoQ; Sensor histidine protein kinase/phosphatase PhoQ |
UniProt ID | Q57QC4 |
◆ Recombinant Proteins | ||
WDR76-10149M | Recombinant Mouse WDR76 Protein, His (Fc)-Avi-tagged | +Inquiry |
Chrna1-778R | Recombinant Rat Chrna1 Protein, His-tagged | +Inquiry |
CYC1-20H | Recombinant Human CYC1 protein, GST-tagged | +Inquiry |
S-491S | Active Recombinant SARS-CoV-2 (2019-nCoV) Spike S1(D614G) Protein, His-tagged, HPLC-verified | +Inquiry |
GNGT1-7042M | Recombinant Mouse GNGT1 Protein | +Inquiry |
◆ Native Proteins | ||
PLAU-8456H | Active Native Human PLAU | +Inquiry |
GSN-874P | Active Native Porcine GSN Protein | +Inquiry |
KLKB1-211S | Active Native Porcine Kallikrein | +Inquiry |
Troponin T-12H | Native Human cardiac Troponin T protein | +Inquiry |
F12-5397H | Active Native Human Coagulation Factor XII (Hageman factor) | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCDH10-1293HCL | Recombinant Human PCDH10 cell lysate | +Inquiry |
YEATS4-248HCL | Recombinant Human YEATS4 293 Cell Lysate | +Inquiry |
FAM9B-592HCL | Recombinant Human FAM9B cell lysate | +Inquiry |
F9-1768MCL | Recombinant Mouse F9 cell lysate | +Inquiry |
ERC2-6569HCL | Recombinant Human ERC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All phoQ Products
Required fields are marked with *
My Review for All phoQ Products
Required fields are marked with *
0
Inquiry Basket