Recombinant Full Length Salmonella Choleraesuis Rhomboid Protease Glpg(Glpg) Protein, His-Tagged
Cat.No. : | RFL5881SF |
Product Overview : | Recombinant Full Length Salmonella choleraesuis Rhomboid protease glpG(glpG) Protein (Q57IV1) (1-276aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella choleraesuis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-276) |
Form : | Lyophilized powder |
AA Sequence : | MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDIWLADESQAERVRVELARFIENPG DPRYLAASWQSGQTNSGLRYRRFPFLATLRERAGPVTWIVMIACVLVYIAMSLIGDQTVM VWLAWPFDPVLKFEVWRYFTHIFMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITVV SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALLWIVAG WFDWFGMSMANGAHIAGLIVGLAMAFVDTLNARKRT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | glpG |
Synonyms | glpG; SCH_3455; Rhomboid protease GlpG; Intramembrane serine protease |
UniProt ID | Q57IV1 |
◆ Recombinant Proteins | ||
AP3S2-350R | Recombinant Rhesus monkey AP3S2 Protein, His-tagged | +Inquiry |
ROR1-1815HAF555 | Recombinant Human ROR1 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
TGFB1-153H | Active Recombinant Human TGFB1 Protein | +Inquiry |
CMYB-8860Z | Recombinant Zebrafish CMYB | +Inquiry |
JUND-6855Z | Recombinant Zebrafish JUND | +Inquiry |
◆ Native Proteins | ||
LIPO-02E | Native Escherichia coli Lipopolysaccharides | +Inquiry |
GC-524H | Native Human GC protein | +Inquiry |
Lectin-1809M | Active Native Maackia Amurensis Lectin II Protein, Biotinylated | +Inquiry |
COL1A1-23M | Native Mouse Collagen I Protein | +Inquiry |
ALB-115C | Native Chicken Serum Albumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZSCAN20-2006HCL | Recombinant Human ZSCAN20 cell lysate | +Inquiry |
HIST1H2BN-5534HCL | Recombinant Human HIST1H2BN 293 Cell Lysate | +Inquiry |
SCRN1-2021HCL | Recombinant Human SCRN1 293 Cell Lysate | +Inquiry |
PYCRL-2646HCL | Recombinant Human PYCRL 293 Cell Lysate | +Inquiry |
VOPP1-399HCL | Recombinant Human VOPP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All glpG Products
Required fields are marked with *
My Review for All glpG Products
Required fields are marked with *
0
Inquiry Basket