Recombinant Full Length Salmonella Choleraesuis Putative 2-Aminoethylphosphonate Transport System Permease Protein Phnu(Phnu) Protein, His-Tagged
Cat.No. : | RFL31696SF |
Product Overview : | Recombinant Full Length Salmonella choleraesuis Putative 2-aminoethylphosphonate transport system permease protein phnU(phnU) Protein (Q57SD7) (1-286aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella choleraesuis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-286) |
Form : | Lyophilized powder |
AA Sequence : | MSLILPLEKPALNLRPLLWLLLPLLVLATLFFWPLSLIVEQALRGANGEIGLETFRHVVD SKRFVGALLNTLQIAFFATAGCLLLGSAMSLILVFIPFPGSELIGRVVDTFIALPTFLIT LAFTFIYGSAGLLNGTLMSLFAFELPPVDFLYSMQGVILAEITVFTPLVMRPLMAALRQI DKSQLEAASILGAHPLRVIGQVIFPAALPALMAGGSLCLLLTTNEFGIVLFIGAKGVNTL PMMVYSKAILESDYTVACMIALINIVLSLGLFSLYRLAASRTGVRS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | phnU |
Synonyms | phnU; SCH_0468; Putative 2-aminoethylphosphonate transport system permease protein PhnU |
UniProt ID | Q57SD7 |
◆ Recombinant Proteins | ||
FCAMR-235H | Recombinant Human FCAMR Protein, C-His-tagged | +Inquiry |
RFL36864CF | Recombinant Full Length Coxiella Burnetii Succinate Dehydrogenase Hydrophobic Membrane Anchor Subunit(Sdhd) Protein, His-Tagged | +Inquiry |
REG1B-90C | Recombinant Cynomolgus REG1B, Fc tagged | +Inquiry |
DPP4-2845H | Recombinant Human DPP4 Protein, GST-tagged | +Inquiry |
PLA2G4A-526H | Recombinant Human PLA2G4A protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
LTF-175H | Native Human lactoferrin | +Inquiry |
IgG-332S | Native Swine IgG | +Inquiry |
Fibronectin-13R | Native Rat Fibronectin Protein | +Inquiry |
IgM-208M | Native Monkey Immunoglobulin M | +Inquiry |
CNTF-26839TH | Native Human CNTF | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRAK3-5170HCL | Recombinant Human IRAK3 293 Cell Lysate | +Inquiry |
SLC35A4-1733HCL | Recombinant Human SLC35A4 293 Cell Lysate | +Inquiry |
SLCO1A2-1691HCL | Recombinant Human SLCO1A2 293 Cell Lysate | +Inquiry |
P2RY1-1267HCL | Recombinant Human P2RY1 cell lysate | +Inquiry |
PPP4R4-2910HCL | Recombinant Human PPP4R4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All phnU Products
Required fields are marked with *
My Review for All phnU Products
Required fields are marked with *
0
Inquiry Basket