Recombinant Full Length Salmonella Choleraesuis Lipoprotein Signal Peptidase(Lspa) Protein, His-Tagged
Cat.No. : | RFL5419SF |
Product Overview : | Recombinant Full Length Salmonella choleraesuis Lipoprotein signal peptidase(lspA) Protein (Q57TL4) (1-166aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella choleraesuis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-166) |
Form : | Lyophilized powder |
AA Sequence : | MSKPLCSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVGLFPSLNLHYARNYGAAFSF LADSGGWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGF VVDMIDFYVGNWHFATFNLADSAICIGAALIVLEGFLPKPTAKEQA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lspA |
Synonyms | lspA; SCH_0041; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II |
UniProt ID | Q57TL4 |
◆ Recombinant Proteins | ||
STXBP3-001H | Recombinant Human syntaxin binding protein 3 Protein, His-tagged | +Inquiry |
WIPF3-4308H | Recombinant Human WIPF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACBD5B-5863Z | Recombinant Zebrafish ACBD5B | +Inquiry |
PRDX1-2033C | Recombinant Cricetulus Griseus PRDX1 Protein (2-199 aa), His-tagged | +Inquiry |
Fgf2-061M | Active Recombinant Mouse Fgf2 Protein | +Inquiry |
◆ Native Proteins | ||
HGB-144G | Native Guinea Pig Hemoglobin protein | +Inquiry |
Factor Ixa-62H | Native Human Factor Ixa | +Inquiry |
SPARC-287B | Native Bovine Osteonectin | +Inquiry |
Lectin-1747L | Active Native Lotus Tetragonolobus Lectin Protein | +Inquiry |
b-Glucosidase-10S | Active Native Sweet Almonds b-Glucosidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCTN6-7037HCL | Recombinant Human DCTN6 293 Cell Lysate | +Inquiry |
KCNT1-5014HCL | Recombinant Human KCNT1 293 Cell Lysate | +Inquiry |
RELT-2418HCL | Recombinant Human RELT cell lysate | +Inquiry |
ATP5SL-8593HCL | Recombinant Human ATP5SL 293 Cell Lysate | +Inquiry |
TSLP-1742MCL | Recombinant Mouse TSLP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lspA Products
Required fields are marked with *
My Review for All lspA Products
Required fields are marked with *
0
Inquiry Basket