Recombinant Full Length Salmonella Arizonae Upf0442 Protein Yjjb(Yjjb) Protein, His-Tagged
Cat.No. : | RFL29996SF |
Product Overview : | Recombinant Full Length Salmonella arizonae UPF0442 protein yjjB(yjjB) Protein (A9MRX4) (1-157aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella arizonae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-157) |
Form : | Lyophilized powder |
AA Sequence : | MGIIDFFMALMQDMILSAIPAVGFAMVFNVPHRALPWCALLGALGHGSRMLMMSAGFNIE WSTFMASLLVGSIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISHLGYSEP MMITLLTNFLKASSIVGALSIGLSVPGLWLYRKRPRV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yjjB |
Synonyms | yjjB; SARI_03035; UPF0442 protein YjjB |
UniProt ID | A9MRX4 |
◆ Recombinant Proteins | ||
RFL23913PF | Recombinant Full Length Pinus Thunbergii Photosystem Ii D2 Protein(Psbd) Protein, His-Tagged | +Inquiry |
MEIS3-1774H | Recombinant Human MEIS3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CD247-222H | Recombinant Human CD247 Protein, His-tagged | +Inquiry |
POU3F2-4584R | Recombinant Rat POU3F2 Protein | +Inquiry |
WRN-12H | Recombinant Human WRN Protein, 517-1093, N-GST tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1822P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Agarose bound | +Inquiry |
TF-31158TH | Native Human TF | +Inquiry |
B. pertussis-36 | Native B. pertussis Filamentous Hemagglutinin Antigen | +Inquiry |
20S Immunoproteasome-225C | Active Native Cynomolgus monkey 20S Immunoproteasome protein | +Inquiry |
PGK-100Y | Active Native Yeast 3-Phosphoglyceric Phosphokinase | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCTD1-5012HCL | Recombinant Human KCTD1 293 Cell Lysate | +Inquiry |
ACPP-1880HCL | Recombinant Human ACPP cell lysate | +Inquiry |
ANKRD13D-8856HCL | Recombinant Human ANKRD13D 293 Cell Lysate | +Inquiry |
ISLR-5148HCL | Recombinant Human ISLR 293 Cell Lysate | +Inquiry |
RAP1A-2530HCL | Recombinant Human RAP1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yjjB Products
Required fields are marked with *
My Review for All yjjB Products
Required fields are marked with *
0
Inquiry Basket