Recombinant Full Length Salmonella Agona Fumarate Reductase Subunit C(Frdc) Protein, His-Tagged
Cat.No. : | RFL32512SF |
Product Overview : | Recombinant Full Length Salmonella agona Fumarate reductase subunit C(frdC) Protein (B5F2L9) (1-131aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella agona |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-131) |
Form : | Lyophilized powder |
AA Sequence : | MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKHGAESWMGF VGFLQNPVVVILNLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKGLWVVTAVV TVVILYVALFW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | frdC |
Synonyms | frdC; SeAg_B4619; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C |
UniProt ID | B5F2L9 |
◆ Recombinant Proteins | ||
PTRH2-3411C | Recombinant Chicken PTRH2 | +Inquiry |
Imp4-3528M | Recombinant Mouse Imp4 Protein, Myc/DDK-tagged | +Inquiry |
MAPK11-122HFL | Unactive Recombinant Full Length Human MAPK11 Protein, N-GST-tagged | +Inquiry |
GPR17-5208H | Recombinant Human GPR17 Protein | +Inquiry |
SH-RS06590-5528S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS06590 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
DNASE1-8333B | Native Bovine DNASE1 | +Inquiry |
FN1-28900TH | Native Human FN1 | +Inquiry |
IgM-235H | Native Human Immunoglobulin M (IgM) | +Inquiry |
CRP-5330H | Native Canine CRP protein | +Inquiry |
B2M-8046H | Native Human Beta 2 MicroGlobulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF713-2080HCL | Recombinant Human ZNF713 cell lysate | +Inquiry |
CCDC107-148HCL | Recombinant Human CCDC107 lysate | +Inquiry |
STYX-1370HCL | Recombinant Human STYX 293 Cell Lysate | +Inquiry |
C16orf72-8246HCL | Recombinant Human C16orf72 293 Cell Lysate | +Inquiry |
NME5-3788HCL | Recombinant Human NME5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All frdC Products
Required fields are marked with *
My Review for All frdC Products
Required fields are marked with *
0
Inquiry Basket