Recombinant Full Length Salmon Pancreas Disease Virus Structural Polyprotein Protein, His-Tagged
Cat.No. : | RFL14277SF |
Product Overview : | Recombinant Full Length Salmon pancreas disease virus Structural polyprotein Protein (Q8JJX0) (860-1320aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmon pancreas disease virus (SPDV) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (860-1320) |
Form : | Lyophilized powder |
AA Sequence : | YEHTVVVPMDPRAPSYEAVINRNGYDPLKLTISVNFTVISPTTALEYWTCAGVPIVEPPH VGCCTSVSCPSDLSTLHAFTGKAVSDVHCDVHTNVYPLLWGAAHCFCSTENTQVSAVAAT VSEFCAQDSERAEAFSVHSSSVTAEVLVTLGEVVTAVHVYVDGVTSARGTDLKIVAGPIT TDYSPFDRKVVRIGEEVYNYDWPPYGAGRPGTFGDIQARSTNYVKPNDLYGDIGIEVLQP TNDHVHVAYTYTTSGLLRWLQDAPKPLSVTAPHGCKISANPLLALDCGVGAVPMSINIPD AKFTRKLKDPKPSALKCVVDSCEYGVDYGGAATITYEGHEAGKCGIHSLTPGVPLRTSVV EVVAGANTVKTTFSSPTPEVALEVEICSAIVKCAGECTPPKEHVVATRPRHGSDPGGYIS GPAMRWAGGIVGTLVVLFLILAVIYCVVKKCRSKRIRIVKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Salmon pancreas disease virus Structural polyprotein |
Synonyms | Structural polyprotein; p130 |
UniProt ID | Q8JJX0 |
◆ Native Proteins | ||
HPIV3ag-275V | Active Native Parainfluenza Virus type 3(strain III v 2932) Protein | +Inquiry |
HP-127H | Native Human Hemoglobin protein | +Inquiry |
BL-001C | Native Cynomolgus Brain Total Protein Lysates | +Inquiry |
CAT-5276H | Native Human, Catalase | +Inquiry |
Heartworm-021C | Native Canine Heartworm Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR151-740HCL | Recombinant Human GPR151 cell lysate | +Inquiry |
HADH-5646HCL | Recombinant Human HADH 293 Cell Lysate | +Inquiry |
PARD6B-3435HCL | Recombinant Human PARD6B 293 Cell Lysate | +Inquiry |
CCDC11-7790HCL | Recombinant Human CCDC11 293 Cell Lysate | +Inquiry |
GRN-2791HCL | Recombinant Human GRN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Salmon pancreas disease virus Structural polyprotein Products
Required fields are marked with *
My Review for All Salmon pancreas disease virus Structural polyprotein Products
Required fields are marked with *
0
Inquiry Basket