Recombinant Full Length Saccharomyces Cerevisiae Uncharacterized Protein Ymr187C (Ymr187C) Protein, His-Tagged
Cat.No. : | RFL22873SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Uncharacterized protein YMR187C (YMR187C) Protein (Q03236) (1-431aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-431) |
Form : | Lyophilized powder |
AA Sequence : | MTPPHFFLSLIKKRCICWICLEESTYDSTWLQHTCGCNLQIHKRCYIRWLYQMHVELFLP NTVDLPKDADLPIITCLKCLVDGHHDFMTTFSLTEIWETRPIWGQKSVPFQNDYVFNLMS LYTKRDNHPPYVLVKFGECPQCKKTNFIKRPTVTIQSSVLSLFYQWQKITRYVIPLGITS LFLLNPEKTSFDIGLWQLRCLFPENVLRNMLNISTTKALDVYAQTERGLLSIPLTSSIII YGFIHYLSNISNVSANAILFKWVYLSIVKTAGNKYYKGIGLPKIILYSNLATFCYNFTFK RLVDLIYRRLINKGGKYLYHGNFENSSNSVPAEEFFIRRNWYAILAEKILWPFVGKCTGG LLLNAFLWIQRKFKIEWTPNCSPSEFRMIFNIIGCGTAAIGWSSLKLYASYKRCQELEKI NEFIEQSCKGE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | YMR187C |
Synonyms | YMR187C; YM8010.17C; Uncharacterized protein YMR187C |
UniProt ID | Q03236 |
◆ Recombinant Proteins | ||
PIEZO1-4446R | Recombinant Rat PIEZO1 Protein | +Inquiry |
DZANK1-4031Z | Recombinant Zebrafish DZANK1 | +Inquiry |
GRIK5-5341H | Recombinant Human GRIK5 Protein | +Inquiry |
RFL32283BF | Recombinant Full Length Bovine Leukocyte Surface Antigen Cd53(Cd53) Protein, His-Tagged | +Inquiry |
KPNA2-2262R | Recombinant Rhesus Macaque KPNA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
C. abortus-35 | Native Chlamydia abortus Antigen | +Inquiry |
FABP1-509H | Native Human FABP1 | +Inquiry |
CAT-1187B | Native Bovine Catalase | +Inquiry |
F10-267B | Active Native Bovine Factor X | +Inquiry |
F10-290M | Active Native Mouse Factor X | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTPS2-7196HCL | Recombinant Human CTPS2 293 Cell Lysate | +Inquiry |
CTTNBP2NL-7188HCL | Recombinant Human CTTNBP2NL 293 Cell Lysate | +Inquiry |
KLHL29-890HCL | Recombinant Human KLHL29 cell lysate | +Inquiry |
EIF1B-244HCL | Recombinant Human EIF1B lysate | +Inquiry |
MRPL27-4183HCL | Recombinant Human MRPL27 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All YMR187C Products
Required fields are marked with *
My Review for All YMR187C Products
Required fields are marked with *
0
Inquiry Basket