Recombinant Full Length Saccharomyces Cerevisiae Uncharacterized Protein Yil029C (Yil029C) Protein, His-Tagged
Cat.No. : | RFL20104SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Uncharacterized protein YIL029C (YIL029C) Protein (P40538) (1-142aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-142) |
Form : | Lyophilized powder |
AA Sequence : | MRLIFIAKMLQYSFLPFSPFNLLNFDNSISVSWFITYSVIVSIWGFAVWIEGAYRNKINL QLPRCTKIKCSRYNTRIKSPKWFNCKNWMHFFLLYLFLTASNLIVQLAYFSKEMCSQGIN VPGTKKPGNRVYLSVIILMGNG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | YIL029C |
Synonyms | YIL029C; Uncharacterized protein YIL029C |
UniProt ID | P40538 |
◆ Recombinant Proteins | ||
SLC9A3R2-15531M | Recombinant Mouse SLC9A3R2 Protein | +Inquiry |
GINS3-3562M | Recombinant Mouse GINS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL26556ZF | Recombinant Full Length Zygnema Circumcarinatum Nad(P)H-Quinone Oxidoreductase Subunit 4L, Chloroplastic(Ndhe) Protein, His-Tagged | +Inquiry |
YOBF-3631B | Recombinant Bacillus subtilis YOBF protein, His-tagged | +Inquiry |
INPP5K-5104H | Recombinant Human INPP5K Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
ALB-311H | Native Human Albumin, Texas Red Label | +Inquiry |
BGLAP-59B | Native Bovine Osteocalcin | +Inquiry |
ALB-8301S | Native Sheep ALB | +Inquiry |
POPG-42 | Active Native Pyruvate oxidase | +Inquiry |
RPE-426 | Native RPE | +Inquiry |
◆ Cell & Tissue Lysates | ||
GJB3-5918HCL | Recombinant Human GJB3 293 Cell Lysate | +Inquiry |
AKT1-677HCL | Recombinant Human AKT1 cell lysate | +Inquiry |
OAT-449HCL | Recombinant Human OAT lysate | +Inquiry |
TMEM19-682HCL | Recombinant Human TMEM19 lysate | +Inquiry |
Atrium-224H | Human Heart: Atrium (LT) Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YIL029C Products
Required fields are marked with *
My Review for All YIL029C Products
Required fields are marked with *
0
Inquiry Basket