Recombinant Full Length Saccharomyces Cerevisiae Uncharacterized Membrane Protein Ydl180W(Ydl180W) Protein, His-Tagged
Cat.No. : | RFL8969SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Uncharacterized membrane protein YDL180W(YDL180W) Protein (Q12301) (1-547aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-547) |
Form : | Lyophilized powder |
AA Sequence : | MVRLNHAASYFMPIFCSTRPHIVILSALFSISLFSLFYASSELLLHQYDDPLMFKPNSQD YFRTFLLGLFSPFLYYFLKTFLFNINQRFLILNLIVDFPINDVFMLLILIGLAYPQVQDH EGGTIKHKECSWHIIPRQAYIFGISWALGEFTICIIGNLFNYQEIADPNINSGFTHQESA NTYCNNNDMSHNDDCGCSTEYRPNVVDRSDITLSKCIEVRNDSSSISNNVYSSEYHPIKP LRSSSSTYGSIRQQPHENKKQLHVPDNSQDDTIIMMNPIDNSLKLTTLDTGDLSFPIDEE QPILKKSFGYTWAVPNENTQNTTKSFTPIKRFIAFSTAYQLVTGLLLMILVVGSNIMLTI GESLILSMYFVYVRGHEGLFTPVVNYFGSRTISNFILCVIIPFISLNFLINTSIYLRREL DDWFNNSQGEFEDDDENTISKRVATNQEYQHPLSANYISMDSPDVINSSPGHFGMNSGQL LGNTTLYYGSLNGDDDDMTNDSALLRFCKKLVKNWRALARNDSFVLGVMVSWSLLVFVTG ILSTVYI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | YDL180W |
Synonyms | YDL180W; Uncharacterized membrane protein YDL180W |
UniProt ID | Q12301 |
◆ Recombinant Proteins | ||
CD38-194H | Recombinant Human CD38 Protein, His-tagged | +Inquiry |
SERPINI2-997H | Recombinant Human SERPINI2 Protein, MYC/DDK-tagged | +Inquiry |
DDIT4L-7855H | Recombinant Human DDIT4L protein, GST-tagged | +Inquiry |
SAP028A-033-4557S | Recombinant Staphylococcus aureus (strain: WB43S, other: ST73-MRSA-IVa (2B)) SAP028A_033 protein, His-tagged | +Inquiry |
SMYD3-4354R | Recombinant Rhesus monkey SMYD3 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-017R | Native Rabbit IgG Isotype Control, R-Phycoerythrin Conjugated | +Inquiry |
THBS-260H | Native Human Thrombospondin | +Inquiry |
RWV-307S | Native Snake RVV-V ACTIVATOR | +Inquiry |
Pancreas-002H | Human Pancreas Lysate, Total Protein | +Inquiry |
FGF1-33B | Active Native Bovine FGF1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
UFC1-522HCL | Recombinant Human UFC1 293 Cell Lysate | +Inquiry |
PRKCDBP-2858HCL | Recombinant Human PRKCDBP 293 Cell Lysate | +Inquiry |
C7orf31-7968HCL | Recombinant Human C7orf31 293 Cell Lysate | +Inquiry |
SPATA5L1-1533HCL | Recombinant Human SPATA5L1 293 Cell Lysate | +Inquiry |
TRAF3-822HCL | Recombinant Human TRAF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All YDL180W Products
Required fields are marked with *
My Review for All YDL180W Products
Required fields are marked with *
0
Inquiry Basket