Recombinant Full Length Saccharomyces Cerevisiae Topoisomerase I Damage Affected Protein 7(Tda7) Protein, His-Tagged
Cat.No. : | RFL8215SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Topoisomerase I damage affected protein 7(TDA7) Protein (E7QJS8) (1-636aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-636) |
Form : | Lyophilized powder |
AA Sequence : | MNSNSTIGRTTLGESDTISLSFSEPSSSLNSRSTDVVFASTSTLVPQQGSLTSLPPVSST ATPTYYSTSLTYDETLHTSIDVSSTSTLVSSTDSSSSSEQDTYSSQYDPATSSYSIITPS MSIFSSTSPMSSSSSITSEWSSLTSTTPTLSSSATSLSSSWSSLSSPSSLLVSSSLSLSL SSSYSDTKLFSFDSRSSIFSPSTPTVISPSYTYLSSISATSFQISTTSELSSSWFSTISS PSTTSNKDTTFPSSSRNTSTSFYSSSLSSTNDFSTISKSSKLSPSASSSTVSISTISVPT SSSVSSSSSKVPSNRPSSSSSSDDTTSAYSSTYTFQSLQSTTSSSIPPTTQTPSTSTIST SPIPTSSQVFNTVAISSSEDSKTIYYFYTQTYDITDSSTTFVTGLPTTIAVAKSEVTSFS APSSTITADMSFYQHWLDGSLDNNKNQGTSKTNTGTIVGSVVGSVGGILICVLVVWFMLV RKRKAKRHFKENDSFCHEIGRRTGFPTTAQAKEASLQAQDSGSQQRNTETASANNPFSNE FNFKARGNPPPVPPPRNVTAMNGSFQNMRSNFMDQENRFSYGSSFTYSSLGSSTQGGFST LSSNSIRLGRGLDNDISHDERNTVQNNSQGFLREII |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TDA7 |
Synonyms | TDA7; VL3_4038; Topoisomerase I damage affected protein 7 |
UniProt ID | E7QJS8 |
◆ Recombinant Proteins | ||
PARD6B-6496M | Recombinant Mouse PARD6B Protein, His (Fc)-Avi-tagged | +Inquiry |
Plbd2-016H | Recombinant Hamster phospholipase B domain containing 2 Protein, His tagged | +Inquiry |
CHCHD8-3375M | Recombinant Mouse CHCHD8 Protein | +Inquiry |
IL4R-588H | Active Recombinant Human IL4R Protein, His & Avi-tagged, Biotinylated | +Inquiry |
DHODH-1961H | Recombinant Human DHODH Protein (Thr31-Arg395), His tagged | +Inquiry |
◆ Native Proteins | ||
SERPINF2-27145TH | Native Human SERPINF2 | +Inquiry |
SERPINE1-29522TH | Native Human SERPINE1 | +Inquiry |
IgY-005C | Native Chicken IgY Ig Fraction | +Inquiry |
FGA-42D | Native Canine Fibrinogen, FITC Labeled | +Inquiry |
FGG -36D | Native Canine Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRCP-7291HCL | Recombinant Human CRCP 293 Cell Lysate | +Inquiry |
Lung-307H | Human Lung (Pulmonary embolism) Lysate | +Inquiry |
TBC1D3C-1221HCL | Recombinant Human TBC1D3C 293 Cell Lysate | +Inquiry |
APOA1BP-8790HCL | Recombinant Human APOA1BP 293 Cell Lysate | +Inquiry |
DUSP14-6781HCL | Recombinant Human DUSP14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TDA7 Products
Required fields are marked with *
My Review for All TDA7 Products
Required fields are marked with *
0
Inquiry Basket