Recombinant Full Length Saccharomyces Cerevisiae Topoisomerase I Damage Affected Protein 7(Tda7) Protein, His-Tagged
Cat.No. : | RFL18612SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Topoisomerase I damage affected protein 7(TDA7) Protein (C7GTF0) (1-636aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-636) |
Form : | Lyophilized powder |
AA Sequence : | MNSNSTIGRTTLGESDTISLSFSEPSSSLNSRSTDVVFASTSTLVPQQGSLTSLPPVSST ATPTYYSTSLTYDETLHTSIDVSSTSTLVSSTDSSSSSEQDTYSSQYDPATSSYSIITPS MSIFSSTSPMSSSSSITSEWSSLTSTTPTLSSSATSLSSSWSSLSSPSSLLVSSSLSLSL SSSYSDTKLFSFDSRSSIFSPSTPTVISPSYTYLSSISATSFQISTTSELSSSWFSTISS PSTTSNKDTTFPSSSRNTSTSFYSSSLSSTNDFSTISKSSKLSPSASSSTVSISTISVPT SSSVSSSSSKVPSNRPSSSSSSDDTTSAYSSTYTFQSLQSTTSSSIPPTTQTPSTSTIST SPIPTSSQVFNTVAISSSEDSKTIYYFYTQTYDITDSSTTFVTGLPTTIAVAKSEVTSFS APSSTITADMSFYQHWLDGSLDNNKNQGTSKTNTGTIVGSVVGSVGGILICVLVVWFMLV RKRKAKRHFKENDSFCHEIGRRTGFPTTAQAKEASLQAQDSGSQQRNTETASANNPFSNE FNFKARGNPPPVPPPRNVTAMNGSFQNMRSNFMDQENRFSYGSSFTYSSLGSSTQGGFST LSSNSIRLGRGLDNDISHDERNTVQNNSQGFLREII |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TDA7 |
Synonyms | TDA7; C1Q_03716; Topoisomerase I damage affected protein 7 |
UniProt ID | C7GTF0 |
◆ Recombinant Proteins | ||
SH3BGRL-1946C | Recombinant Chicken SH3BGRL | +Inquiry |
ABCB5-190M | Recombinant Mouse ABCB5 Protein, His (Fc)-Avi-tagged | +Inquiry |
TAF5L-16398M | Recombinant Mouse TAF5L Protein | +Inquiry |
PIP5K1BA-1450Z | Recombinant Zebrafish PIP5K1BA | +Inquiry |
AIM2-1159H | Recombinant Human AIM2 protein(Met1-Thr343), GST-tagged | +Inquiry |
◆ Native Proteins | ||
TF-5341H | Native Human Transferring | +Inquiry |
S100A11-3111H | Native Human S100A11 protein(Met1-Thr105) | +Inquiry |
Tropomyosin/Troponin-895R | Native Rabbit Tropomyosin/Troponin Protein | +Inquiry |
H1F0-01B | Native Bovine H1F0 Protein | +Inquiry |
HGF-38P | Native Porcine HGF | +Inquiry |
◆ Cell & Tissue Lysates | ||
PNKD-3083HCL | Recombinant Human PNKD 293 Cell Lysate | +Inquiry |
Duodenum-110H | Human Duodenum Liver Cirrhosis Lysate | +Inquiry |
CTSZ-1603HCL | Recombinant Human CTSZ cell lysate | +Inquiry |
ZNF507-61HCL | Recombinant Human ZNF507 293 Cell Lysate | +Inquiry |
ATP5O-8595HCL | Recombinant Human ATP5O 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TDA7 Products
Required fields are marked with *
My Review for All TDA7 Products
Required fields are marked with *
0
Inquiry Basket