Recombinant Full Length Saccharomyces Cerevisiae Topoisomerase I Damage Affected Protein 7(Tda7) Protein, His-Tagged
Cat.No. : | RFL29502SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Topoisomerase I damage affected protein 7(TDA7) Protein (P53882) (1-636aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-636) |
Form : | Lyophilized powder |
AA Sequence : | MNSNSTIGRTTLGESDTISLSFSEPSSSLNSRSTDVVFASTSTLVPQQGSLTSLPPVSST ATPTYYSTSLTYDETLHTSIDVSSTSTLVSSTDSSSSSEQDTYSSQYDPATSSYSIITPS MSIFSSTSPMSSSSSITSEWSSLTSTTPTLSSSATSLSSSWSSLSSPSSLLVSSSLSLSL SSSYSDTKLFSFDSRSSIFSPSTPTVISPSYTYLSSISATSFQISTTSELSSSWFSTISS PSTISNKDTTFPSSSRNTSTSFYSSSLSSTNDFSTISKSSKLSPSASSSTVSISTISVPT SSSVSSSSSKVPSNRPSSSSSSDDTTSAYSSTYTFQSLQSTTSSSIPPTTQTPSTSTIST SPIPTSSQVFNTVAISSSEDSKTIYYFYTQTYDITDSSTTFVTGLPTTIAVAKSEVTSFS APSSTITADMSFYQHWLDGSLDNNKNQGTSKTNTGTIVGSVVGSVGGILICVLVVWFMLV RKRKAKRHFKENDSFCHEIGRRTGFPTTAQAKEASLQAQDSGSQQRNTETASANNPFSNE FNFKARGNPPPVPPPRNVTAMNGSFQNMRSNFMDQENRFSYGSSFTYSSLGSSTQGGFST LSSNSIRLGRGLDNDISHDERNTVQNNSQGFLREII |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TDA7 |
Synonyms | TDA7; YNL176C; N1661; Topoisomerase I damage affected protein 7 |
UniProt ID | P53882 |
◆ Recombinant Proteins | ||
RFL-1430DF | Recombinant Full Length Danio Rerio Alkaline Ceramidase 1(Acer1) Protein, His-Tagged | +Inquiry |
CD59-3013HF | Recombinant Full Length Human CD59 Protein, GST-tagged | +Inquiry |
NEK9-2902H | Recombinant Human NEK9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TUBA3B-6358R | Recombinant Rat TUBA3B Protein | +Inquiry |
SENP2-152H | Active Recombinant Human SENP2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TNC-50H | Native Human Tenascin C | +Inquiry |
APOA2-608H | Native Human Apolipoprotein A-II | +Inquiry |
Lectin-1822P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Agarose bound | +Inquiry |
HPIV3ag-275V | Active Native Parainfluenza Virus type 3(strain III v 2932) Protein | +Inquiry |
KS-01G | Active Native Goat KS Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LSS-396HCL | Recombinant Human LSS lysate | +Inquiry |
RFC2-2412HCL | Recombinant Human RFC2 293 Cell Lysate | +Inquiry |
HA-2335HCL | Recombinant H2N2 HA cell lysate | +Inquiry |
Lung-755B | Bovine Lung Membrane Lysate, Total Protein | +Inquiry |
ERI3-501HCL | Recombinant Human ERI3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TDA7 Products
Required fields are marked with *
My Review for All TDA7 Products
Required fields are marked with *
0
Inquiry Basket