Recombinant Full Length Saccharomyces Cerevisiae Sterol O-Acyltransferase 1(Are1) Protein, His-Tagged
Cat.No. : | RFL33565SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Sterol O-acyltransferase 1(ARE1) Protein (P25628) (1-610aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-610) |
Form : | Lyophilized powder |
AA Sequence : | MTETKDLLQDEEFLKIRRLNSAEANKRHSVTYDNVILPQESMEVSPRSSTTSLVEPVEST EGVESTEAERVAGKQEQEEEYPVDAHMQKYLSHLKSKSRSRFHRKDASKYVSFFGDVSFD PRPTLLDSAINVPFQTTFKGPVLEKQLKNLQLTKTKTKATVKTTVKTTEKTDKADAPPGE KLESNFSGIYVFAWMFLGWIAIRCCTDYYASYGSAWNKLEIVQYMTTDLFTIAMLDLAMF LCTFFVVFVHWLVKKRIINWKWTGFVAVSIFELAFIPVTFPIYVYYFDFNWVTRIFLFLH SVVFVMKSHSFAFYNGYLWDIKQELEYSSKQLQKYKESLSPETREILQKSCDFCLFELNY QTKDNDFPNNISCSNFFMFCLFPVLVYQINYPRTSRIRWRYVLEKVCAIIGTIFLMMVTA QFFMHPVAMRCIQFHNTPTFGGWIPATQEWFHLLFDMIPGFTVLYMLTFYMIWDALLNCV AELTRFADRYFYGDWWNCVSFEEFSRIWNVPVHKFLLRHVYHSSMGALHLSKSQATLFTF FLSAVFHEMAMFAIFRRVRGYLFMFQLSQFVWTALSNTKFLRARPQLSNVVFSFGVCSGP SIIMTLYLTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ARE1 |
Synonyms | ARE1; SAT2; YCR048W; YCR48W; Sterol O-acyltransferase 1; Sterol-ester synthase 1 |
UniProt ID | P25628 |
◆ Recombinant Proteins | ||
SLC8A3-5525C | Recombinant Chicken SLC8A3 | +Inquiry |
ATP5G3-458R | Recombinant Rhesus monkey ATP5G3 Protein, His-tagged | +Inquiry |
RPS21-114H | Recombinant Human RPS21 protein, GST-tagged | +Inquiry |
Art v 3.02-03A | Recombinant Artemisia vulgaris Art v 3.02 Protein, His-tagged | +Inquiry |
RFL14024DF | Recombinant Full Length Desulfitobacterium Hafniense Glycerol-3-Phosphate Acyltransferase 1(Plsy1) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
IgM-235H | Native Human Immunoglobulin M (IgM) | +Inquiry |
GSN-876P | Active Native Porcine GSN Protein | +Inquiry |
Avidin-015 | Native Avidin Protein, Peroxidase conjugated | +Inquiry |
Thromboplastin-079B | Native Bovine Thromboplastin Protein | +Inquiry |
LDL-394H | Native Human Low Density Lipoprotein, Biotin labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRFAP1L1-4207HCL | Recombinant Human MRFAP1L1 293 Cell Lysate | +Inquiry |
KIAA1279-002HCL | Recombinant Human KIAA1279 cell lysate | +Inquiry |
CERK-7567HCL | Recombinant Human CERK 293 Cell Lysate | +Inquiry |
YIF1A-247HCL | Recombinant Human YIF1A 293 Cell Lysate | +Inquiry |
NEIL2-3881HCL | Recombinant Human NEIL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ARE1 Products
Required fields are marked with *
My Review for All ARE1 Products
Required fields are marked with *
0
Inquiry Basket