Recombinant Full Length Saccharomyces Cerevisiae Squalene Synthase(Erg9) Protein, His-Tagged
Cat.No. : | RFL16440SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Squalene synthase(ERG9) Protein (P29704) (1-444aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-444) |
Form : | Lyophilized powder |
AA Sequence : | MGKLLQLALHPVEMKAALKLKFCRTPLFSIYDQSTSPYLLHCFELLNLTSRSFAAVIREL HPELRNCVTLFYLILRALDTIEDDMSIEHDLKIDLLRHFHEKLLLTKWSFDGNAPDVKDR AVLTDFESILIEFHKLKPEYQEVIKEITEKMGNGMADYILDENYNLNGLQTVHDYDVYCH YVAGLVGDGLTRLIVIAKFANESLYSNEQLYESMGLFLQKTNIIRDYNEDLVDGRSFWPK EIWSQYAPQLKDFMKPENEQLGLDCINHLVLNALSHVIDVLTYLAGIHEQSTFQFCAIPQ VMAIATLALVFNNREVLHGNVKIRKGTTCYLILKSRTLRGCVEIFDYYLRDIKSKLAVQD PNFLKLNIQISKIEQFMEEMYQDKLPPNVKPNETPIFLKVKERSRYDDELVPTQQEEEYK FNMVLSIILSVLLGFYYIYTLHRA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ERG9 |
Synonyms | ERG9; YHR190W; Squalene synthase; SQS; SS; FPP:FPP farnesyltransferase; Farnesyl-diphosphate farnesyltransferase |
UniProt ID | P29704 |
◆ Recombinant Proteins | ||
CDK19/CCNC/MED12-1659H | Recombinant Human CDK19/CCNC/MED12 Protein (M1-Y502/M1-S283/M1-D100), GST/Flag/His-tagged | +Inquiry |
ESYT2-2872M | Recombinant Mouse ESYT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MMP14-3296R | Recombinant Rhesus monkey MMP14 protein, His-tagged | +Inquiry |
RFL34571CF | Recombinant Full Length Cycas Taitungensis Chloroplast Envelope Membrane Protein(Cema) Protein, His-Tagged | +Inquiry |
PCNT-045H | Recombinant Human pericentrin Protein, His tagged | +Inquiry |
◆ Native Proteins | ||
Proteasome 20S-37H | Native Human Proteasome 20S Protein, Tag Free | +Inquiry |
SHBG-30637TH | Native Human SHBG protein | +Inquiry |
IgY-006D | Native Duck IgY | +Inquiry |
H1N12099-209I | Native H1N1 (A/New Caledonia/20/99) H1N12099 protein | +Inquiry |
slo-01S | Active Native Streptococcus pyogenes Streptolysin O protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-2370HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
HILPDA-322HCL | Recombinant Human HILPDA lysate | +Inquiry |
CD36-2400MCL | Recombinant Mouse CD36 cell lysate | +Inquiry |
C9orf114-135HCL | Recombinant Human C9orf114 lysate | +Inquiry |
SW480-23HL | Human SW480 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERG9 Products
Required fields are marked with *
My Review for All ERG9 Products
Required fields are marked with *
0
Inquiry Basket