Recombinant Full Length Saccharomyces Cerevisiae Spore Membrane Assembly Protein 2(Sma2) Protein, His-Tagged
Cat.No. : | RFL15722SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Spore membrane assembly protein 2(SMA2) Protein (A6ZLZ9) (1-369aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-369) |
Form : | Lyophilized powder |
AA Sequence : | MLFPKRLIVWGVLLILSLSQFVLYLPATTCTNSKGLRLCAPQFTITVIGGSSTANEFIAS VREFLRLISYLTIDMGWSNEFTDPSVYEDENLVDTFQPDKVFELNYFGFCKRSNKSKVYC TSNENYGMDVLEVLVRDVGIQLGNISTTRSNETKKFGDSLVLTYRLALTSIRDFLKHDKH TGNALSKALIGSPDPNVKGASPTKNYLKGVNLAFILMMFNGMVFYFAVLEIIVGFLSICV VSAFGGALSVGKRHRLFPILLKSSSSILVVIATLTILCNIVYLIALKTLEPEEVTDVGSD NAAVHTTGWELLKVNVGSGFIMGLARYAIQWVLLVLAFLAANHYKAKPKKSDKYTEDTSN SPSPDLMEK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SMA2 |
Synonyms | SMA2; SCY_4111; Spore membrane assembly protein 2 |
UniProt ID | A6ZLZ9 |
◆ Recombinant Proteins | ||
SLC16A2-87H | Recombinant Human SLC16A2 Protein | +Inquiry |
SCO1231-1367S | Recombinant Streptomyces coelicolor A3(2) SCO1231 protein, His-tagged | +Inquiry |
FAIM-1545R | Recombinant Rhesus monkey FAIM Protein, His-tagged | +Inquiry |
CTSH-478H | Active Recombinant Human CTSH, His-tagged | +Inquiry |
DCAF11-1444R | Recombinant Rat DCAF11 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
PLAU-22H | Native Human PLAU protein | +Inquiry |
FGF2-26551TH | Native Human FGF2 | +Inquiry |
Annexin-V-011H | Native Human Annexin-V Protein, FITC conjugated | +Inquiry |
Troponin-01H | Native Human Troponin Protein | +Inquiry |
Lectin-1755C | Active Native Canavalia ensiformis Concanavalin A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOP16-3765HCL | Recombinant Human NOP16 293 Cell Lysate | +Inquiry |
HOOK3-5433HCL | Recombinant Human HOOK3 293 Cell Lysate | +Inquiry |
MAPK7-4490HCL | Recombinant Human MAPK7 293 Cell Lysate | +Inquiry |
IL5-456CCL | Recombinant Canine IL5 cell lysate | +Inquiry |
ZNF823-3HCL | Recombinant Human ZNF823 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SMA2 Products
Required fields are marked with *
My Review for All SMA2 Products
Required fields are marked with *
0
Inquiry Basket