Recombinant Full Length Saccharomyces Cerevisiae Sphingosine N-Acyltransferase Lac1(Lac1) Protein, His-Tagged
Cat.No. : | RFL27024SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Sphingosine N-acyltransferase LAC1(LAC1) Protein (A6ZZV7) (1-418aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-418) |
Form : | Lyophilized powder |
AA Sequence : | MSTIKPSPSNNNLKVRSRPRRKSSIGKIDLGDTVPSLGTMFETKESKTAAKRRMQRLSEA TKNDSDLVKKIWFSFREISYRHAWIAPLMILIAVYSAYFTSGNTTKTNVLHRFVAVSYQI GDTNAYGKGINDLCFVFYYMIFFTFLREFLMDVVIRPFAIRLHVTSKHRIKRIMEQMYAI FYTGVSGPFGIYCMYHSDLWFFNTKAMYRTYPDFTNPFLFKVFYLGQAAFWAQQACILVL QLEKPRKDHNELTFHHIVTLLLIWSSYVFHFTKMGLPIYITMDVSDFLLSFSKTLNYLDS GLAFFSFAIFVVAWIYLRHYINLKILWSVLTQFRTEGNYVLNFATQQYKCWISLPIVFVL IGALQLVNLYWLFLIFRVLYRILWRGILKDDRSDSESDEESDESSTTPTDSTPTKKDI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LAC1 |
Synonyms | LAC1; SCY_3367; Sphingosine N-acyltransferase LAC1 |
UniProt ID | A6ZZV7 |
◆ Recombinant Proteins | ||
MC5R-3267R | Recombinant Rat MC5R Protein, His (Fc)-Avi-tagged | +Inquiry |
DDT-847H | Recombinant Human DDT, MYC/DDK-tagged | +Inquiry |
cre-145B | Recombinant Bacteriophage P1 cre protein, T7/His-tagged | +Inquiry |
C10orf47-432H | Recombinant Human C10orf47 Protein, GST-tagged | +Inquiry |
TNKS-0836H | Recombinant Human TNKS Protein (Q1091-Q1325), His tagged | +Inquiry |
◆ Native Proteins | ||
LDH1-218H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
Brain-10H | Native Human Brain Tissue Protein/Lysate | +Inquiry |
ACTC1-5294H | Native Human Actin, Alpha, Cardiac Muscle 1 | +Inquiry |
SNCA-27339TH | Native Human SNCA | +Inquiry |
Mb-8229M | Native Mouse Myoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
GGA1-698HCL | Recombinant Human GGA1 cell lysate | +Inquiry |
CORO2A-7342HCL | Recombinant Human CORO2A 293 Cell Lysate | +Inquiry |
TAC1-1289HCL | Recombinant Human TAC1 293 Cell Lysate | +Inquiry |
HYAL1-5325HCL | Recombinant Human HYAL1 293 Cell Lysate | +Inquiry |
TMEM170A-990HCL | Recombinant Human TMEM170A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LAC1 Products
Required fields are marked with *
My Review for All LAC1 Products
Required fields are marked with *
0
Inquiry Basket