Recombinant Full Length Saccharomyces Cerevisiae Sphingoid Long-Chain Base Transporter Rsb1(Rsb1) Protein, His-Tagged
Cat.No. : | RFL8489SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Sphingoid long-chain base transporter RSB1(RSB1) Protein (A6ZNQ4) (1-382aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-382) |
Form : | Lyophilized powder |
AA Sequence : | MSNATNNTLGSLLPQLEAAANSNSLYGGMVPNLRFNITMIVIWGILLTIHVVQLLMRQYW FSIAFICTGILEVLGFIGRTWSHSNVADMDAFLLNMICLTIAPVFTMGGIYYQLAKLIEV YGHRFSLLPSPMAYSFIFICSDIVSLVVQAVGGGLCGVAVTDGTSTTTGNHVFIAGLAIQ VASMAIFLMLWFHFLFRIYISVRWEHINSRPISLSLLKISQTEVDYLYREKFHFLRLEPK RWVFHYFNLAMTVAVLTIFTRCCYRLAELVVGWDGYLITHEWYFIILDALMMAIATVTLT IFHPGFAFKGRSTSIPITPRHVDPETLPHTDDVEDILDTSDSKQFDIEKEEFQASMKYPI STFKQFMSKIANLFSSKKKAKL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RSB1 |
Synonyms | RSB1; SCY_5122; Sphingoid long-chain base transporter RSB1 |
UniProt ID | A6ZNQ4 |
◆ Recombinant Proteins | ||
EFHD2-4214HF | Recombinant Full Length Human EFHD2 Protein, GST-tagged | +Inquiry |
PNP4B-11674Z | Recombinant Zebrafish PNP4B | +Inquiry |
ACTC1-818HF | Recombinant Full Length Human ACTC1 Protein, GST-tagged | +Inquiry |
JAK2-3136R | Recombinant Rat JAK2 Protein | +Inquiry |
CD33-0712H | Recombinant Human CD33 protein, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
FSH-930B | Active Native Bovine FSH Protein | +Inquiry |
DEF-196H | Native Human Defensins | +Inquiry |
Ferrous Hemoglobin-033H | Native Human Ferrous Hemoglobin Protein | +Inquiry |
Factor XIIa-66H | Native Human Factor XIIa | +Inquiry |
Lectin-1865W | Active Native Succinylated Wheat Germ Agglutinin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF343-2015HCL | Recombinant Human ZNF343 cell lysate | +Inquiry |
LCORL-4796HCL | Recombinant Human LCORL 293 Cell Lysate | +Inquiry |
CD3D & CD3E-1726MCL | Recombinant Mouse CD3D & CD3E cell lysate | +Inquiry |
Uterus-665G | Guinea Pig Uterus Lysate, Total Protein | +Inquiry |
Kidney-072MCL | Adult Mouse Kidney Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RSB1 Products
Required fields are marked with *
My Review for All RSB1 Products
Required fields are marked with *
0
Inquiry Basket