Recombinant Full Length Saccharomyces Cerevisiae Signal Peptidase Complex Subunit Spc1(Spc1) Protein, His-Tagged
Cat.No. : | RFL29235SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Signal peptidase complex subunit SPC1(SPC1) Protein (P46965) (1-94aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-94) |
Form : | Lyophilized powder |
AA Sequence : | MSEILQDVQRKLVFPIDFPSQRKTEKFQQLSLMIGALVACILGFAQQSLKVLLTAYGISC VITLICVLPAYPWYNKQKLRWAQPKIEINVDQYD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPC1 |
Synonyms | SPC1; YJR010C-A; YJR010BW; Signal peptidase complex subunit SPC1; Microsomal signal peptidase subunit 1 |
UniProt ID | P46965 |
◆ Recombinant Proteins | ||
RFL27307SF | Recombinant Full Length Staphylococcus Aureus Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged | +Inquiry |
groL-643C | Recombinant Coxiella burnetii (strain CbuG_Q212) groL protein, His&Myc-tagged | +Inquiry |
SOX10-5675R | Recombinant Rat SOX10 Protein | +Inquiry |
Bhmt-709M | Recombinant Mouse Bhmt Protein, MYC/DDK-tagged | +Inquiry |
PYCARD-29108H | Recombinant Human PYCARD, GST-tagged | +Inquiry |
◆ Native Proteins | ||
IgA-242D | Native Dog Immunoglobulin A | +Inquiry |
SV40gp6-268 | Active Native Simian virus 40 SV40gp6 protein | +Inquiry |
BNP-1276P | Native Porcine Brain Natriuretic Peptide | +Inquiry |
TGFB1-21H | Active Native Human TGF- β1 | +Inquiry |
Alb-113R | Native Rat Serum Albumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTDSPL-7207HCL | Recombinant Human CTDSPL 293 Cell Lysate | +Inquiry |
PCBD2-3404HCL | Recombinant Human PCBD2 293 Cell Lysate | +Inquiry |
NDFIP2-1175HCL | Recombinant Human NDFIP2 cell lysate | +Inquiry |
SSX1-1450HCL | Recombinant Human SSX1 293 Cell Lysate | +Inquiry |
FOXN3-6150HCL | Recombinant Human FOXN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPC1 Products
Required fields are marked with *
My Review for All SPC1 Products
Required fields are marked with *
0
Inquiry Basket