Recombinant Full Length Saccharomyces Cerevisiae Serine Palmitoyltransferase 2(Lcb2) Protein, His-Tagged
Cat.No. : | RFL8288SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Serine palmitoyltransferase 2(LCB2) Protein (P40970) (1-561aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-561) |
Form : | Lyophilized powder |
AA Sequence : | MSTPANYTRVPLCEPEELPDDIQKENEYGTLDSPGHLYQVKSRHGKPLPEPVVDTPPYYI SLLTYLNYLILIILGHVHDFLGMTFQKNKHLDLLEHDGLAPWFSNFESFYVRRIKMRIDD CFSRPTTGVPGRFIRCIDRISHNINEYFTYSGAVYPCMNLSSYNYLGFAQSKGQCTDAAL ESVDKYSIQSGGPRAQIGTTDLHIKAEKLVARFIGKEDALVFSMGYGTNANLFNAFLDKK CLVISDELNHTSIRTGVRLSGAAVRTFKHGDMVGLEKLIREQIVLGQPKTNRPWKKILIC AEGLFSMEGTLCNLPKLVELKKKYKCYLFIDEAHSIGAMGPTGRGVCEIFGVDPKDVDIL MGTFTKSFGAAGGYIAADQWIIDRLRLDLTTVSYSESMPAPVLAQTISSLQTISGEICPG QGTERLQRIAFNSRYLRLALQRLGFIVYGVADSPVIPLLLYCPSKMPAFSRMMLQRRIAV VVVAYPATPLIESRVRFCMSASLTKEDIDYLLRHVSEVGDKLNLKSNSGKSSYDGKRQRW DIEEVIRRTPEDCKDDKYFVN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LCB2 |
Synonyms | LCB2; SCS1; TSC1; YDR062W; D4246; YD9609.16; Serine palmitoyltransferase 2; SPT 2; Long chain base biosynthesis protein 2 |
UniProt ID | P40970 |
◆ Recombinant Proteins | ||
DENND6A-1440H | Recombinant Human DENND6A | +Inquiry |
Arhgef37-1693M | Recombinant Mouse Arhgef37 Protein, Myc/DDK-tagged | +Inquiry |
GPR81-13490H | Recombinant Human GPR81, GST-tagged | +Inquiry |
PRKCI-4341R | Recombinant Rat PRKCI Protein, His (Fc)-Avi-tagged | +Inquiry |
GLTP-4908C | Recombinant Chicken GLTP | +Inquiry |
◆ Native Proteins | ||
RV-11 | Native Rubella Virus Antigen | +Inquiry |
LDH1-218H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
SERPINF2-27145TH | Native Human SERPINF2 | +Inquiry |
LTF-230B | Native Bovine Apo-Lactoferrin | +Inquiry |
Proc-5346M | Native Mouse Protein C | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUV39H1-1334HCL | Recombinant Human SUV39H1 293 Cell Lysate | +Inquiry |
RSPRY1-2128HCL | Recombinant Human RSPRY1 293 Cell Lysate | +Inquiry |
CD3G-7675HCL | Recombinant Human CD3G 293 Cell Lysate | +Inquiry |
PPAPDC1A-2990HCL | Recombinant Human PPAPDC1A 293 Cell Lysate | +Inquiry |
ANPEP-3090HCL | Recombinant Human ANPEP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LCB2 Products
Required fields are marked with *
My Review for All LCB2 Products
Required fields are marked with *
0
Inquiry Basket