Recombinant Full Length Saccharomyces Cerevisiae Serine Palmitoyltransferase 1(Lcb1) Protein, His-Tagged
Cat.No. : | RFL18888SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Serine palmitoyltransferase 1(LCB1) Protein (P25045) (1-558aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-558) |
Form : | Lyophilized powder |
AA Sequence : | MAHIPEVLPKSIPIPAFIVTTSSYLWYYFNLVLTQIPGGQFIVSYIKKSHHDDPYRTTVE IGLILYGIIYYLSKPQQKKSLQAQKPNLSPQEIDALIEDWEPEPLVDPSATDEQSWRVAK TPVTMEMPIQNHITITRNNLQEKYTNVFNLASNNFLQLSATEPVKEVVKTTIKNYGVGAC GPAGFYGNQDVHYTLEYDLAQFFGTQGSVLYGQDFCAAPSVLPAFTKRGDVIVADDQVSL PVQNALQLSRSTVYYFNHNDMNSLECLLNELTEQEKLEKLPAIPRKFIVTEGIFHNSGDL APLPELTKLKNKYKFRLFVDETFSIGVLGATGRGLSEHFNMDRATAIDITVGSMATALGS TGGFVLGDSVMCLHQRIGSNAYCFSACLPAYTVTSVSKVLKLMDSNNDAVQTLQKLSKSL HDSFASDDSLRSYVIVTSSPVSAVLHLQLTPAYRSRKFGYTCEQLFETMSALQKKSQTNK FIEPYEEEEKFLQSIVDHALINYNVLITRNTIVLKQETLPIVPSLKICCNAAMSPEELKN ACESVKQSILACCQESNK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LCB1 |
Synonyms | LCB1; END8; TSC2; YMR296C; Serine palmitoyltransferase 1; SPT 1; SPT1; Long chain base biosynthesis protein 1 |
UniProt ID | P25045 |
◆ Recombinant Proteins | ||
AHDC1-1005HF | Recombinant Full Length Human AHDC1 Protein, GST-tagged | +Inquiry |
MOB1BA-10544Z | Recombinant Zebrafish MOB1BA | +Inquiry |
ADRB2-30C | Recombinant Cynomolgus Monkey ADRB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL4-203H | Recombinant Active Human IL4 Protein, His-tagged(C-ter) | +Inquiry |
IL18BP-162H | Recombinant Human IL18BP protein, hFc-tagged | +Inquiry |
◆ Native Proteins | ||
FGG -47P | Native Porcine Fibrinogen, FITC Labeled | +Inquiry |
LYZ-29007TH | Active Native Human LYZ | +Inquiry |
APOA1-23D | Native Dog Apolipoprotein A1 (APOA1) Protein | +Inquiry |
Collagen-316B | Native Bovine Collagen Type II | +Inquiry |
Lectin-1729G | Active Native Griffonia Simplicifolia Lectin I Protein, Rhodamine labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
Oak-699P | Oak Lysate, Total Protein | +Inquiry |
NP-003HCL | Recombinant H3N2 NP cell lysate | +Inquiry |
SYT5-1303HCL | Recombinant Human SYT5 293 Cell Lysate | +Inquiry |
VSTM1-1683HCL | Recombinant Human VSTM1 cell lysate | +Inquiry |
Diaphragm-104C | Cynomolgus monkey Diaphragm Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All LCB1 Products
Required fields are marked with *
My Review for All LCB1 Products
Required fields are marked with *
0
Inquiry Basket