Recombinant Full Length Saccharomyces Cerevisiae Sensitive To High Expression Protein 9, Mitochondrial(She9) Protein, His-Tagged
Cat.No. : | RFL32606SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Sensitive to high expression protein 9, mitochondrial(SHE9) Protein (A6ZYZ4) (31-456aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (31-456) |
Form : | Lyophilized powder |
AA Sequence : | FHYSSYSLQNDDTPDKGSTNKSEIRTPNNTVWKENIELQWQHLKKKLNELYSRFNFHRDQ LSFQVNKAKKSIQEANRKLSEQENEINDSRLNYNKDELTSAKIEGLPSEREQHRKKWSRK LEFYFDSLQETLFTATRALNDVTGYSGIQKLKSSISLMEKKLEATKKEHKLFKAQYANAI DERAQSQREVNELLQRQSAWSSSDLERFTQLYKNDALNARQEQELKNKVKEIESKEEQLN DDLYRAILTRYHEEQIWSDKIRRTSTWGTFILMGMNIFLFIVLQLLLEPWKRKRLVGSFE DKVKSALNEYAKEQNMKMDKLLPGKSSEVTDQGNTKNSIVEEHIEQRGECKINTAETDRP EVATAEATTTAMKSFRDIWERIKALFVTLKSIQYRKLDAPLVFDTLEFYLYSISLVSMTI LVSGLI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SHE9 |
Synonyms | SHE9; MDM33; SCY_1282; Sensitive to high expression protein 9, mitochondrial; Mitochondrial distribution and morphology protein 33 |
UniProt ID | A6ZYZ4 |
◆ Recombinant Proteins | ||
IFNK-112H | Recombinant Human IFNK, GST-tagged | +Inquiry |
IL4-3105H | Recombinant Human IL4 protein, His-SUMO-tagged | +Inquiry |
RFL13626SF | Recombinant Full Length Salmonella Paratyphi A Protein Cysz(Cysz) Protein, His-Tagged | +Inquiry |
CHSY1-11235H | Recombinant Human CHSY1, GST-tagged | +Inquiry |
AKT3-550H | Recombinant Human AKT3 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
F2-90B | Active Native Bovine Thrombin | +Inquiry |
LN-2686M | Native Mouse LN Protein | +Inquiry |
Cytochrome c-023H | Native Human Cytochrome c Protein | +Inquiry |
Ferritin-025B | Native Bovine Ferritin Protein, apo-form | +Inquiry |
IBV-06I | Native Influenza B Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPATA33-8252HCL | Recombinant Human C16orf55 293 Cell Lysate | +Inquiry |
ACCS-9098HCL | Recombinant Human ACCS 293 Cell Lysate | +Inquiry |
SERPINB6-553HCL | Recombinant Human SERPINB6 cell lysate | +Inquiry |
REEP2-2428HCL | Recombinant Human REEP2 293 Cell Lysate | +Inquiry |
C10orf85-8359HCL | Recombinant Human C10orf85 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SHE9 Products
Required fields are marked with *
My Review for All SHE9 Products
Required fields are marked with *
0
Inquiry Basket