Recombinant Full Length Saccharomyces Cerevisiae Putative Uncharacterized Protein Ylr302C (Ylr302C) Protein, His-Tagged
Cat.No. : | RFL34300SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Putative uncharacterized protein YLR302C (YLR302C) Protein (O13544) (1-120aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-120) |
Form : | Lyophilized powder |
AA Sequence : | MRWHCMDGGNRIVSMYLTTLYYTKEIVDEKTREQEKGKTSFLTDALLNLIYILFFSSSVF NWTRCHLFDTSVIMLHSFHEDGALTNLISHLPTTTVPQYRQLHVPFAILRSCDLKRKSKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | YLR302C |
Synonyms | YLR302C; Uncharacterized protein YLR302C |
UniProt ID | O13544 |
◆ Recombinant Proteins | ||
HIRA-4171M | Recombinant Mouse HIRA Protein, His (Fc)-Avi-tagged | +Inquiry |
CD33-3162HF | Recombinant Full Length Human CD33 Protein, GST-tagged | +Inquiry |
GRP78,BIP-301140H | Recombinant Human GRP78,BIP protein, GST-tagged | +Inquiry |
NOP16-6444H | Recombinant Human NOP16 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RPL23A-2384H | Recombinant Human RPL23A, His-tagged | +Inquiry |
◆ Native Proteins | ||
SERPINF2-27145TH | Native Human SERPINF2 | +Inquiry |
Troponin-16R | Native Rabbit Skeletal Muscle Troponin ITC Complex | +Inquiry |
hypogaea 2S-156A | Native Arachis hypogaea 2S protein | +Inquiry |
ALB-313B | Native Bovine Albumin, Texas Red Label | +Inquiry |
LDL-404H | Native Human Low Density Lipoprotein, Oxidized, Biotin labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
LPCAT1-4672HCL | Recombinant Human LPCAT1 293 Cell Lysate | +Inquiry |
SCNM1-2029HCL | Recombinant Human SCNM1 293 Cell Lysate | +Inquiry |
IL15RA-5246HCL | Recombinant Human IL15RA Overexpression Lysate(Ile31-Thr205) | +Inquiry |
CDH5-2213HCL | Recombinant Human CDH5 cell lysate | +Inquiry |
CREB3L4-397HCL | Recombinant Human CREB3L4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YLR302C Products
Required fields are marked with *
My Review for All YLR302C Products
Required fields are marked with *
0
Inquiry Basket