Recombinant Full Length Saccharomyces Cerevisiae Putative Uncharacterized Protein Ygl042C (Ygl042C) Protein, His-Tagged

• Cat.No.: RFL19090SF
• Product Overview: Recombinant Full Length Saccharomyces cerevisiae Putative uncharacterized protein YGL042C (YGL042C) Protein (P53181) (1-101aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: S.cerevisiae
• Source: E.coli
• Tag: His
• ProteinLength: Full Length (1-101)
• Form: Lyophilized powder
• AA Sequence: MYIVYEYAISTNWIWLYVWLFLFLDSGCQILLRIESEQAFLSLPPIVSFALSVATLIFFY SKRISICYHMLHMYRKWSMVHPQILFAIDSKIPSSLYIYHM
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: YGL042C
• Synonyms: YGL042C; Putative uncharacterized protein YGL042C
• UniProt ID: P53181