Recombinant Full Length Saccharomyces Cerevisiae Protein Tapt1 Homolog (Yer140W) Protein, His-Tagged
Cat.No. : | RFL5941SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Protein TAPT1 homolog (YER140W) Protein (P40085) (1-556aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-556) |
Form : | Lyophilized powder |
AA Sequence : | MQHKDTAVAKDTAKKRLLRRNSAPSAIHIISRLDKKWSFLWNTIDRHNIVEEQDESSAAK SEEEHEDDYELEQLLNMIRIPMFLEKFMLFALLTSLDCFLYYFTVLPIRLIKGYVKQFKS YRQHYRLQQRSGHKNKIPFRYRITSREYKERCMIFIIVISSILLSKLDTSKLYHRIKRQS TMKLYMLFSVLEMADKMLASLGQSLLTVMLSRKNSERILLHKCLLVSMSLTYVTIHGYVL VYQAISLNIAVNSYSNALLTLLLSMQFAEIKSSVLKKFDKEGFFQITIADVVERFKLTLL LSITGLRNLQSWSSSLSNTSINFWSPRSTLSIVINILCGPMVSVVGSEVLVDWAKHAYIT KFNRIRPQIYDKFYYIIYKDYSTRTHKLEDRLGLPLPAFVVLFIVMVRPTLFKSSEPSYL PSLFRILFMGASVFLLALLAKFTLDLILIKWSKRIEQRFRDQAFNTVVTEEEYVPGLLSG GMGKVDVSTRIALHSDYNKENRIETESVSPMRKRKTTLTAECTPPSLNDIRRQKDSKNPR SLENVARYKMVSKRIW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | EMP65 |
Synonyms | EMP65; YER140W; Endoplasmic reticulum membrane protein 65; 65 kDa endoplasmic reticulum membrane protein |
UniProt ID | P40085 |
◆ Recombinant Proteins | ||
RNF41-7687M | Recombinant Mouse RNF41 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL11225PF | Recombinant Full Length Cytochrome B6(Petb) Protein, His-Tagged | +Inquiry |
EPHA5-364H | Active Recombinant Human EPHA5, His-tagged | +Inquiry |
GFM2-1833R | Recombinant Rhesus monkey GFM2 Protein, His-tagged | +Inquiry |
ZRANB2-855H | Recombinant Human ZRANB2 Protein (1-320 aa), His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
Ngf-51M | Native Mouse Nerve Growth Factor 2.5S | +Inquiry |
C3b-06M | Native Mouse C3b Protein | +Inquiry |
Chymotrypsin-163B | Active Native Bovine Chymotrypsin | +Inquiry |
Spinalcord-C57M | Native Mouse C57 Spinal cord protein | +Inquiry |
LYPL-29 | Active Native Lysophospholipase | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM124A-6440HCL | Recombinant Human FAM124A 293 Cell Lysate | +Inquiry |
Eye-722P | Pig Eye, Whole Lysate, Total Protein | +Inquiry |
ZNF562-752HCL | Recombinant Human ZNF562 lysate | +Inquiry |
Skin-804G | Guinea Pig Skin Membrane Lysate, Total Protein | +Inquiry |
TMEM147-999HCL | Recombinant Human TMEM147 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EMP65 Products
Required fields are marked with *
My Review for All EMP65 Products
Required fields are marked with *
0
Inquiry Basket