Recombinant Full Length Saccharomyces Cerevisiae Protein Cos9(Cos9) Protein, His-Tagged
Cat.No. : | RFL7994SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Protein COS9(COS9) Protein (P36034) (1-407aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-407) |
Form : | Lyophilized powder |
AA Sequence : | MQIVRSCNSNNKPLIPSSNWHIAIRMRGDGVKDRSIDVLSLKHFESQKVVLPQDLFMDNF TWMFYEFFKCFTFRTWLLLLLLMWLPGFLSQIKSINRIFPFKLCILVSCLVGIFLPNIYS FSHKSVLTNQLTQFSKEIVEHAPGTDTHDWETVAANLNSYFYENKAWNTEYFFFNAAECQ KAFRKVLLEPFSVKKDESSKIKSFGDSVPYIEEALQVYSTEFDKKWKLFNTEKVWSPDNL EHVQLPKKTYRYKFTWVLKRIFNLWLFPAFILFLACIYVSWDKGHLFRILCCGGGFLLMV RVFQNMRPFSMHMEDKMQFLSTIINEQESGANGWDEIAKKMNRYLFEKKVWTSEEFFFDG IDCEWFFNHFFYRLLSTKKPMFDRPLNVELWPYIKEAQLTRKQAPPV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | COS9 |
Synonyms | COS9; YKL219W; Protein COS9 |
UniProt ID | P36034 |
◆ Recombinant Proteins | ||
CD2-163C | Recombinant Canine CD2, Fc-tagged | +Inquiry |
AYP1020-RS03865-5038S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS03865 protein, His-tagged | +Inquiry |
PTPRJ-1581R | Recombinant Rhesus Monkey PTPRJ Protein, hIgG4-tagged | +Inquiry |
AQP1-0193H | Recombinant Human AQP1 Full Length Transmembrane protein, His-SUMO-tagged | +Inquiry |
GSTK1-1162H | Recombinant Human GSTK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Tropomyosin-894R | Native Rabbit Tropomyosin Protein | +Inquiry |
Elastase-26P | Native Pseudomonas Aeruginosa Elastase | +Inquiry |
CVB6-14 | Native Coxsackievirus B6 Antigen | +Inquiry |
Collagen-60H | Native Human Collagen Type II | +Inquiry |
S100A14-394H | Native Human S100A14 protein(Gly2-His104), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NETO2-3872HCL | Recombinant Human NETO2 293 Cell Lysate | +Inquiry |
RAB37-2602HCL | Recombinant Human RAB37 293 Cell Lysate | +Inquiry |
AURKA-8564HCL | Recombinant Human AURKA 293 Cell Lysate | +Inquiry |
SLC39A1-608HCL | Recombinant Human SLC39A1 lysate | +Inquiry |
CENPQ-7576HCL | Recombinant Human CENPQ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COS9 Products
Required fields are marked with *
My Review for All COS9 Products
Required fields are marked with *
0
Inquiry Basket