Recombinant Full Length Saccharomyces Cerevisiae Protein Asi3(Asi3) Protein, His-Tagged
Cat.No. : | RFL10404SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Protein ASI3(ASI3) Protein (P53983) (1-676aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-676) |
Form : | Lyophilized powder |
AA Sequence : | MSTNILQHVKQLLHNRDVFSFFHNKTGNLNYLDNTTQKPEVFVSPNSTIVSAPTLDSFQA LMEKGNFTTLQLAKVGIRMFFSYSVSKYAVLCFSTAIILNRLTVMSSLRSNSTNIRLPLW SKTLLHLVATLSLVKALLQILSQFGLMHELHVSDTDFYALSVYLFVALSDCIEIFISSTT NVPSLICSDFSIWGLSLNLYIISKMPAGQQHIGDNVELLGAVFHRLVIHLVELFHIRAYR LCGEVILNAGFFTAFVTRTYLNGLDFINICLIHNYFPGFFYISTILLASIGIFLKALFTS NPFRSLYSRYKNLEKWWRSNNYNGEEEFNEIALSLCLLLTSNDYKIFKKSDNVKSVDEVA AFSNSYVVSGHLNQLQSTPEDLLSRKEMTTDSQLPGFARTYLGLFELVRTIILTYSRLLK NLLWSKNFESSIDKKPRVGKRKKRDLNKYVTEKNYKKFLYKPDVKELNIESDLRSLELLL PEDDSSKDYFPPRKIDESVSDEEFDSDMESQLIIDEEKELTHLSSNAVDSDDLEEIAWNI SMWSILNYEMDVHNKVNGPLTRSQYGKRNPQGVLVDVVIERLLHHTNSRYMYKRLNMKDD DKLEFKFDFAFDSCDEVEEMDLSCLICKVNKRNIVTWPCRCLALCDDCRISLGYKGFATC VSCDSEVKGYSKLNIV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ASI3 |
Synonyms | ASI3; YNL008C; N2874; Protein ASI3; Amino acid sensor-independent protein 3 |
UniProt ID | P53983 |
◆ Recombinant Proteins | ||
RFL32563MF | Recombinant Full Length Mouse Ring Finger Protein 148(Rnf148) Protein, His-Tagged | +Inquiry |
ITGA4/ITGB7-356H | Active Recombinant Human ITGA4/ITGB7 protein | +Inquiry |
EPX-3434H | Recombinant Human EPX Protein, GST-tagged | +Inquiry |
BCO2-340C | Recombinant Cynomolgus BCO2 Protein, His-tagged | +Inquiry |
Vars-8222M | Recombinant Mouse Vars protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
HPX-207H | Native Human Hemopexin | +Inquiry |
GABase-01P | Native Pseudomonas fluorescens γ-aminobutyric acid amino transferase, Tag Free | +Inquiry |
Laminin-01H | Native Human Laminin Protein | +Inquiry |
IGHD -21H | Native Human IgD | +Inquiry |
FSH-1566P | Active Native Porcine Stimulating Hormone | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIMK2-4738HCL | Recombinant Human LIMK2 293 Cell Lysate | +Inquiry |
SLC35E2-1731HCL | Recombinant Human SLC35E2 293 Cell Lysate | +Inquiry |
C9orf78-7925HCL | Recombinant Human C9orf78 293 Cell Lysate | +Inquiry |
CDC7-7646HCL | Recombinant Human CDC7 293 Cell Lysate | +Inquiry |
LGALS9C-4760HCL | Recombinant Human LGALS9C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ASI3 Products
Required fields are marked with *
My Review for All ASI3 Products
Required fields are marked with *
0
Inquiry Basket