Recombinant Full Length Saccharomyces Cerevisiae Phosphatidylinositol N-Acetylglucosaminyltransferase Gpi3 Subunit(Spt14) Protein, His-Tagged
Cat.No. : | RFL13512SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit(SPT14) Protein (B5VSZ6) (1-452aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-452) |
Form : | Lyophilized powder |
AA Sequence : | MGFNIAMLCDFFYPQLGGVEFHIYHLSQKLIDLGHSVVIITHAYKDRVGVRHLTNGLKVY HVPFFVIFRETTFPTVFSTFPIIRNILLREQIQIVHSHGSASTFAHEGILHANTMGLRTV FTDHSLYGFNNLTSIWVNKLLTFTLTNIDRVICVSNTCKENMIVRTELSPDIISVIPNAV VSEDFKPRDPTGGTKRKQSRDKIVIVVIGRLFPNKGSDLLTRIIPKVCSSHEDVEFIVAG DGPKFIDFQQMIESHRLQKRVQLLGSVPHEKVRDVLCQGDIYLHASLTEAFGTILVEAAS CNLLIVTTQVGGIPEVLPNEMTVYAEQTSVSDLVQATNKAINIIRSKALDTSSFHDSVSK MYDWMDVAKRTVEIYTNISSTSSADDKDWMKMVANLYKRDGIWAKHLYLLCGIVEYMLFF LLEWLYPRDEIDLAPKWPKKTVSNETKEARET |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPT14 |
Synonyms | SPT14; AWRI1631_160910; Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit; GlcNAc-PI synthesis protein |
UniProt ID | B5VSZ6 |
◆ Recombinant Proteins | ||
NEU4-6019M | Recombinant Mouse NEU4 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLK2-2371H | Recombinant Human KLK2 Protein, His-tagged | +Inquiry |
ADAM17-278H | Recombinant Human ADAM17 Protein, GST-tagged | +Inquiry |
Hlcs-491M | Recombinant Mouse Hlcs Protein, MYC/DDK-tagged | +Inquiry |
TEAD1-3174H | Recombinant Human TEAD1, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CP-1767H | Native Human CP Protein | +Inquiry |
APC-137 | Native Spirulina sp. Allophycocyanin protein | +Inquiry |
PRSS7-42P | Native Porcine Enterokinase | +Inquiry |
Lectin-1836R | Native Ricinus Communis Ricin B Chain Protein | +Inquiry |
Elastase-26P | Native Pseudomonas Aeruginosa Elastase | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-2663HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
SLC19A3-599HCL | Recombinant Human SLC19A3 lysate | +Inquiry |
LYPLAL1-4587HCL | Recombinant Human LYPLAL1 293 Cell Lysate | +Inquiry |
H1FNT-5665HCL | Recombinant Human H1FNT 293 Cell Lysate | +Inquiry |
USP7-671HCL | Recombinant Human USP7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPT14 Products
Required fields are marked with *
My Review for All SPT14 Products
Required fields are marked with *
0
Inquiry Basket