Recombinant Full Length Saccharomyces Cerevisiae Pheromone-Regulated Membrane Protein 5(Prm5) Protein, His-Tagged
Cat.No. : | RFL28167SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Pheromone-regulated membrane protein 5(PRM5) Protein (C8ZAC7) (1-318aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-318) |
Form : | Lyophilized powder |
AA Sequence : | MTVITIAKRGLPKLTTSTSSTTTASSSSTITSVASSSSSLPLLSNSTSSSIIPSITPPSR NGNPYILDSGDMPNGTVFIVVGGIAGVIFLAILLWWVITTYSSHRLTRSVQDYESKMFSA QHTQFYGDSPYMDYPAKENFQDQVHISESDISPGNKDESVKDALVSHTNNEKPFLSNFER PLSSLVSESNRNSLFISPTGDILYKTRLSKLYQESPRLLQKPVIMTSDNVSTNSLVSTIS SSSASSLDNGNEKEVGEDIRKPAKIASSPSRKLLNSPESDGSVNRNHSKGNLLVVQSKRK PTPSTYLEHMLEGKEQDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PRM5 |
Synonyms | PRM5; EC1118_1I12_0606g; Pheromone-regulated membrane protein 5 |
UniProt ID | C8ZAC7 |
◆ Recombinant Proteins | ||
RFL32738CF | Recombinant Full Length Callithrix Argentata Melanocyte-Stimulating Hormone Receptor(Mc1R) Protein, His-Tagged | +Inquiry |
ACE2-1071HFL | Recombinant Human ACE2 protein, His&Flag-tagged | +Inquiry |
NAIP-4659H | Recombinant Human NAIP Protein (Asn923-Val1148), N-His tagged | +Inquiry |
EF1alpha-16 | Recombinant EF1alpha Protein, Myc/His tagged | +Inquiry |
MLST8-26546TH | Recombinant Human MLST8, T7 -tagged | +Inquiry |
◆ Native Proteins | ||
ApoB-3556H | Native Human ApoB | +Inquiry |
GG-191P | Native Porcine Gamma Globulin protein | +Inquiry |
FTH1-28155TH | Native Human FTH1 | +Inquiry |
IgG-356B | Native Bovine Gamma Globulin Fraction | +Inquiry |
HSP90AA1-14H | Native Hsp90 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EBF4-1537HCL | Recombinant Human EBF4 cell lysate | +Inquiry |
Postcentral Gyrus-397H | Human Postcentral Gyrus (Alzheimers Disease) Lysate | +Inquiry |
GPR83-5776HCL | Recombinant Human GPR83 293 Cell Lysate | +Inquiry |
CMAS-7422HCL | Recombinant Human CMAS 293 Cell Lysate | +Inquiry |
Fallopian-125H | Human Fallopian Tube Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PRM5 Products
Required fields are marked with *
My Review for All PRM5 Products
Required fields are marked with *
0
Inquiry Basket