Recombinant Full Length Saccharomyces Cerevisiae Pheromone-Regulated Membrane Protein 5(Prm5) Protein, His-Tagged
Cat.No. : | RFL9051SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Pheromone-regulated membrane protein 5(PRM5) Protein (B5VKJ2) (1-318aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-318) |
Form : | Lyophilized powder |
AA Sequence : | MTVITIAKRGLPKLTTSTSSTTTASSSSTITSVASSSSSLPLLSNSTSSSIIPSITPPSR NGNPYILDSGDMPNGTVFIVVGGIAGVIFLAILLWWVITTYSSHRLTRSVQDYESKMFST QHTQFYGDSPYMDYPAKENFQDQVHISESDISPGNKDESVKDALVSHTNNEKPFLSNFER PLSSLVSESNRNSLFISPTGDILYKTRLSKLYQESPRLLQKPVIMTSDNVSTNSLVSTIS SSSASSLDNGNEKEVGEDIRKPAKIASSPSRKLLNSPESDGSVNRNHSKGNLLVVQSKRK PTPSTYLEHMLEGKEQDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PRM5 |
Synonyms | PRM5; AWRI1631_90510; Pheromone-regulated membrane protein 5 |
UniProt ID | B5VKJ2 |
◆ Recombinant Proteins | ||
MLN-2594H | Recombinant Human MLN protein, His & S-tagged | +Inquiry |
UBA52-6632C | Recombinant Chicken UBA52 | +Inquiry |
PTPRS-3948H | Recombinant Human PTPRS Protein, His (Fc)-Avi-tagged | +Inquiry |
PRDM9-4657R | Recombinant Rat PRDM9 Protein | +Inquiry |
MPXV-0594 | Recombinant Monkeypox Virus J1R Protein, Ankyrin-like Protein | +Inquiry |
◆ Native Proteins | ||
HB-42P | Native Pig Hemoglobin (HB) Protein | +Inquiry |
HSV1-15 | Native Herpes Simplex Virus (HSV) Type 1 Antigen | +Inquiry |
Plasmin-250H | Active Native Human Plasmin | +Inquiry |
TSHB-704H | Native Human Thyroid Stimulating Hormone, Beta | +Inquiry |
IGHA-209H | Native Human Immunoglobulin A (IgA) | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAP30BP-2068HCL | Recombinant Human SAP30BP 293 Cell Lysate | +Inquiry |
BMPR2-2717HCL | Recombinant Human BMPR2 cell lysate | +Inquiry |
APOBEC4-31HCL | Recombinant Human APOBEC4 lysate | +Inquiry |
VAC14-1901HCL | Recombinant Human VAC14 cell lysate | +Inquiry |
TPTE-830HCL | Recombinant Human TPTE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PRM5 Products
Required fields are marked with *
My Review for All PRM5 Products
Required fields are marked with *
0
Inquiry Basket