Recombinant Full Length Saccharomyces Cerevisiae Pheromone A Factor Receptor(Ste3) Protein, His-Tagged
Cat.No. : | RFL18796SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Pheromone a factor receptor(STE3) Protein (P06783) (1-470aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-470) |
Form : | Lyophilized powder |
AA Sequence : | MSYKSAIIGLCLLAVILLAPPLAWHSHTKNIPAIILITWLLTMNLTCIVDAAIWSDDDFL TRWDGKGWCDIVIKLQVGANIGISCAVTNIIYNLHTILKADSVLPDLSSWTKIVKDLVIS LFTPVMVMGFSYLLQVFRYGIARYNGCQNLLSPTWITTVLYTMWMLIWSFVGAVYATLVL FVFYKKRKDVRDILHCTNSGLNLTRFARLLIFCFIIILVMFPFSVYTFVQDLQQVEGHYT FKNTHSSTIWNTIIKFDPGRPIYNIWLYVLMSYLVFLIFGLGSDALHMYSKFLRSIKLGF VLDMWKRFIDKNKEKRVGILLNKLSSRKESRNPFSTDSENYISTCTENYSPCVGTPISQA HFYVDYRIPDDPRKSQNKSKKYLFADKETDDILDEIDLKESRHIPYVTQGQSFDDEISLG GFSKVTLDYSEKLHNSASSNFEGESLCYSPASKEENSSSNEHSSENTAGP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | STE3 |
Synonyms | STE3; YKL178C; Pheromone a factor receptor |
UniProt ID | P06783 |
◆ Recombinant Proteins | ||
MAPK7-6949H | Recombinant Human MAPK7 protein, His & GST-tagged | +Inquiry |
STOML3-4350R | Recombinant Rhesus Macaque STOML3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Orf4-2019V | Recombinant HCoV-HKU1(isolate N1) Orf4 protein(1-109aa), His-tagged | +Inquiry |
RCSD1-5702H | Recombinant Human RCSD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HA-1117I | Recombinant H7N7 (A/chicken/Netherlands/1/03) HA Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1846S | Active Native Soybean Agglutinin Protein, Biotinylated | +Inquiry |
RBP4-247H | Native Human Retinol Binding Protein 4 | +Inquiry |
IgG-206M | Native Monkey Immunoglobulin G | +Inquiry |
AHSG-111H | Native Human Alpha 2 HS Glycoprotein | +Inquiry |
TFRC-249H | Native Human Transferrin Receptor | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD1B & B2M-001HCL | Recombinant Human CD1B & B2M cell lysate | +Inquiry |
CMA1-493HCL | Recombinant Human CMA1 cell lysate | +Inquiry |
METTL4-4356HCL | Recombinant Human METTL4 293 Cell Lysate | +Inquiry |
CAPS-7855HCL | Recombinant Human CAPS 293 Cell Lysate | +Inquiry |
NVL-1237HCL | Recombinant Human NVL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STE3 Products
Required fields are marked with *
My Review for All STE3 Products
Required fields are marked with *
0
Inquiry Basket