Recombinant Full Length Saccharomyces Cerevisiae Nuclear Rim Protein 1(Nur1) Protein, His-Tagged
Cat.No. : | RFL17015SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Nuclear rim protein 1(NUR1) Protein (Q12066) (1-484aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-484) |
Form : | Lyophilized powder |
AA Sequence : | MGSNDLINEAYDDSEVVGEERESKSAWMKRWYQLLTSPLDLQLVINEKLEMINWDAYAKS LAKPLGNFLTILFFIIRLLQDNLIKPNYYKLNVKSGAFDLSKSNKLKEFDYLWEISSSFQ NNNQFYAFQSWYFVTLRFLNNLFRFTIFILLSLNLYVSCKFMFGYFKTYNLFHLKKEFNS PNLTKHNLKDLSKEYYEDIYKQSLWSMLKHFFRGSRDDGPHVNQNEDEIFFQLRKWIPTN FMINLFVSFSPTAIVFLSFSDVSFTSAIAIVFHQYILDYIITKRFQRSVDDDLILSSAAL QEYEDKHIMARINQCSNIDTLSSAMGTRSKTPRIFTTHSLCGEEIREVYNYEKREFEALP KMTESVPGSRETRIKDYGGISQVSDHQSHPIGFHYSPRMSPYYRDKVLDNNLAQSSSNEN LEKGGAYLPNQDQNRPSKSLSPLRKTPLSARQKRFEGSEFNVLNKNDINSILRSPKKKKN YHKR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NUR1 |
Synonyms | NUR1; YDL089W; D2416; Nuclear rim protein 1 |
UniProt ID | Q12066 |
◆ Recombinant Proteins | ||
IL12B-35H | Recombinant Human Interleukin 12B, Fc-Tagged | +Inquiry |
Ccl7-002M | Active Recombinant Mouse Ccl7 Protein | +Inquiry |
ACOT8-7604H | Recombinant Human ACOT8, His-tagged | +Inquiry |
KRTAP10-2-3255H | Recombinant Human KRTAP10-2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SEMA3F-14864M | Active Recombinant Mouse Sema3f protein, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
PTGS2-57S | Native Sheep PTGS2 Protein | +Inquiry |
GPDH-119R | Active Native Rabbit Glycerol-3-phosphate Dehydrogenase | +Inquiry |
CRP-8056H | Native Human C-Reactive Protein | +Inquiry |
APOH-4217H | Native Human APOH protein | +Inquiry |
ALB-320H | Native Human Albumin Rhodamine | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPB1-2423MCL | Recombinant Mouse CPB1 cell lysate | +Inquiry |
CD38-1398CCL | Recombinant Cynomolgus CD38 cell lysate | +Inquiry |
PTH2R-2704HCL | Recombinant Human PTH2R 293 Cell Lysate | +Inquiry |
LRRC75A-AS1-8237HCL | Recombinant Human C17orf45 293 Cell Lysate | +Inquiry |
CDC42EP3-7652HCL | Recombinant Human CDC42EP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NUR1 Products
Required fields are marked with *
My Review for All NUR1 Products
Required fields are marked with *
0
Inquiry Basket