Recombinant Full Length Saccharomyces Cerevisiae Nuclear Rim Protein 1(Nur1) Protein, His-Tagged
Cat.No. : | RFL21934SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Nuclear rim protein 1(NUR1) Protein (B3LGY4) (1-484aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-484) |
Form : | Lyophilized powder |
AA Sequence : | MGSNDLINEAYDDSEVVGEERESKSAWMKRWYQLLTSPLDLQLVINEKLEMINWDAYAKS LAKPLGNFLTILFFIIRLLQDNLIKPNYYKLNVKSGAFDLSKSNKLKEFDYLWEISSSFQ NSNQFYAFQSWYFVTLRFLNNLFRFTIFILLSLNLYVSCKFMFGYFKTYNLFHLKKEFNS PNLTKHNLKDLSKEYYEDIYKQSLWSMLKHFFRGSRDDGPHVNQNEDEIFFQLRKWIPTN FMINLFVSFSPTAIVFLSFSDVSFTSAIAIVFHQYILDYIITKRFQRSVDDDLILSSAAL QEYEDKHIMARINQCSNIDTLSSAMGTRSKTPRIFTTHSLCGEEIREVYNYEKREFEALP KMTESVPGSRETRIKDYGGISQVSDNQSHPIGFHYSPRMSPYYRDKVLDNNLAQSSSNEN LEKGGAFLPNQDQNRPSKSLSPLRKTPLSARQKRFEGSEFNVLNKNDINSILRSPKKKKN YHKR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NUR1 |
Synonyms | NUR1; SCRG_00586; Nuclear rim protein 1 |
UniProt ID | B3LGY4 |
◆ Recombinant Proteins | ||
RPS28-4023R | Recombinant Rhesus monkey RPS28 Protein, His-tagged | +Inquiry |
YJLA-3705B | Recombinant Bacillus subtilis YJLA protein, His-tagged | +Inquiry |
RFL36153RF | Recombinant Full Length Rat P2Y Purinoceptor 12(P2Ry12) Protein, His-Tagged | +Inquiry |
FAM166B-3004M | Recombinant Mouse FAM166B Protein, His (Fc)-Avi-tagged | +Inquiry |
S-067S | Recombinant SARS-CoV-2 Spike RBD (A522V) Mutant Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1758C | Active Native Canavalia ensiformis Concanavalin A Protein, Cy3 labeled | +Inquiry |
Lipoproteins-13H | Natve Human Lipoproteins, Very Low Density | +Inquiry |
GFAP-171B | Native bovine GFAP | +Inquiry |
IgM-255H | Native Human Rheumatoid Factor IgM | +Inquiry |
CA 19-9-378H | Active Native Human Cancer Antigen 19-9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGER-1480HCL | Recombinant Human AGER cell lysate | +Inquiry |
IGHMBP2-5260HCL | Recombinant Human IGHMBP2 293 Cell Lysate | +Inquiry |
CSTB-7224HCL | Recombinant Human CSTB 293 Cell Lysate | +Inquiry |
YBX2-1946HCL | Recombinant Human YBX2 cell lysate | +Inquiry |
FAM3D-1311MCL | Recombinant Mouse FAM3D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NUR1 Products
Required fields are marked with *
My Review for All NUR1 Products
Required fields are marked with *
0
Inquiry Basket