Recombinant Full Length Saccharomyces Cerevisiae Nuclear Envelope Morphology Protein 1(Nem1) Protein, His-Tagged
Cat.No. : | RFL19643SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Nuclear envelope morphology protein 1(NEM1) Protein (P38757) (1-446aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-446) |
Form : | Lyophilized powder |
AA Sequence : | MNALKYFSNHLITTKKQKKINVEVTKNQDLLGPSKEVSNKYTSHSENDCVSEVDQQYDHS SSHLKESDQNQERKNSVPKKPKALRSILIEKIASILWALLLFLPYYLIIKPLMSLWFVFT FPLSVIERRVKHTDKRNRGSNASENELPVSSSNINDSSEKTNPKNCNLNTIPEAVEDDLN ASDEIILQRDNVKGSLLRAQSVKSRPRSYSKSELSLSNHSSSNTVFGTKRMGRFLFPKKL IPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGLSGIRTLYFIHKRP YCDLFLTKVSKWYDLIIFTASMKEYADPVIDWLESSFPSSFSKRYYRSDCVLRDGVGYIK DLSIVKDSEENGKGSSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPF LEAMRYSTDVRNILALKHGEKAFNIN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NEM1 |
Synonyms | NEM1; YHR004C; Nuclear envelope morphology protein 1 |
UniProt ID | P38757 |
◆ Recombinant Proteins | ||
SMURF1-4167H | Recombinant Human SMURF1 protein(198-374aa), His-GST-tagged | +Inquiry |
Pla2g1b-1185M | Recombinant Mouse Pla2g1b protein(Met1-Cys146), His-tagged | +Inquiry |
trxB-2366E | Recombinant E.coli Thioredoxin Reductase | +Inquiry |
WDR81-18506M | Recombinant Mouse WDR81 Protein | +Inquiry |
SOX2-2049H | Recombinant Human SRY (Sex Determining Region Y)-Box 2, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1747L | Active Native Lotus Tetragonolobus Lectin Protein | +Inquiry |
Lectin-1804L | Active Native Lycopersicon Esculentum Lectin Protein, DyLight 649 labeled | +Inquiry |
CDA002 | Active Native Human MUC16 Protein | +Inquiry |
IGHE -22H | Native Human IgE | +Inquiry |
HYAL1-39B | Active Native Bovine Hyaluronidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
IBTK-5317HCL | Recombinant Human IBTK 293 Cell Lysate | +Inquiry |
SEMA3A-1770MCL | Recombinant Mouse SEMA3A cell lysate | +Inquiry |
GRIPAP1-5740HCL | Recombinant Human GRIPAP1 293 Cell Lysate | +Inquiry |
CLU-2195MCL | Recombinant Mouse CLU cell lysate | +Inquiry |
PKDCC-1025HCL | Recombinant Human PKDCC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All NEM1 Products
Required fields are marked with *
My Review for All NEM1 Products
Required fields are marked with *
0
Inquiry Basket