Recombinant Full Length Saccharomyces Cerevisiae Mitochondrial Respiratory Chain Complexes Assembly Protein Afg3(Afg3) Protein, His-Tagged
Cat.No. : | RFL18089SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Mitochondrial respiratory chain complexes assembly protein AFG3(AFG3) Protein (P39925) (1-761aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-761) |
Form : | Lyophilized powder |
AA Sequence : | MMMWQRYARGAPRSLTSLSFGKASRISTVKPVLRSRMPVHQRLQTLSGLATRNTIHRSTQ IRSFHISWTRLNENRPNKEGEGKNNGNKDNNSNKEDGKDKRNEFGSLSEYFRSKEFANTM FLTIGFTIIFTLLTPSSNNSGDDSNRVLTFQDFKTKYLEKGLVSKIYVVNKFLVEAELVN TKQVVSFTIGSVDIFEEQMDQIQDLLNIPPRDRIPIKYIERSSPFTFLFPFLPTIILLGG LYFITRKINSSPPNANGGGGGGLGGMFNVGKSRAKLFNKETDIKISFKNVAGCDEAKQEI MEFVHFLKNPGKYTKLGAKIPRGAILSGPPGTGKTLLAKATAGEANVPFLSVSGSEFVEM FVGVGASRVRDLFTQARSMAPSIIFIDEIDAIGKERGKGGALGGANDEREATLNQLLVEM DGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVNGRQQIYLVHLKRLNLDP LLTDDMNNLSGKLATLTPGFTGADIANACNEAALIAARHNDPYITIHHFEQAIERVIAGL EKKTRVLSKEEKRSVAYHEAGHAVCGWFLKYADPLLKVSIIPRGQGALGYAQYLPPDQYL ISEEQFRHRMIMALGGRVSEELHFPSVTSGAHDDFKKVTQMANAMVTSLGMSPKIGYLSF DQNDGNFKVNKPFSNKTARTIDLEVKSIVDDAHRACTELLTKNLDKVDLVAKELLRKEAI TREDMIRLLGPRPFKERNEAFEKYLDPKSNTEPPEAPAATN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AFG3 |
Synonyms | AFG3; YTA10; YER017C; Mitochondrial respiratory chain complexes assembly protein AFG3; ATPase family gene 3 protein; Tat-binding homolog 10 |
UniProt ID | P39925 |
◆ Recombinant Proteins | ||
RFL27172HF | Recombinant Full Length Human Protein Lifeguard 1(Grina) Protein, His-Tagged | +Inquiry |
DAG1-999R | Recombinant Rhesus Macaque DAG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL17627SF | Recombinant Full Length Protein Psie(Psie) Protein, His-Tagged | +Inquiry |
IREB2-3095R | Recombinant Rat IREB2 Protein | +Inquiry |
GLT8D2-6372H | Recombinant Human GLT8D2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Lectin-1855V | Active Native Vicia Villosa Lectin Protein, Agarose bound | +Inquiry |
MDH-38P | Active Native Porcine Malate dehydrogenase | +Inquiry |
CTSL1-1859H | Native Human Cathepsin L1 | +Inquiry |
Copper containing Amine oxidase-004B | Active Native Bovine Copper containing Amine oxidase Protein | +Inquiry |
Troponin T-12H | Native Human cardiac Troponin T protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SFTPC-1896HCL | Recombinant Human SFTPC 293 Cell Lysate | +Inquiry |
MRPL27-4183HCL | Recombinant Human MRPL27 293 Cell Lysate | +Inquiry |
HSP90B1-5360HCL | Recombinant Human HSP90B1 293 Cell Lysate | +Inquiry |
ZNF44-2027HCL | Recombinant Human ZNF44 cell lysate | +Inquiry |
SCGB1A1-1794MCL | Recombinant Mouse SCGB1A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All AFG3 Products
Required fields are marked with *
My Review for All AFG3 Products
Required fields are marked with *
0
Inquiry Basket