Recombinant Full Length Saccharomyces Cerevisiae J Domain-Containing Protein 1(Jid1) Protein, His-Tagged
Cat.No. : | RFL19070SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae J domain-containing protein 1(JID1) Protein (Q12350) (1-301aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-301) |
Form : | Lyophilized powder |
AA Sequence : | MLHHKFVYPFLFKWHLSCVEKCPPQITFIAKYATANDKNGNRKLTIRDEQWPELADPTPY DIFGIPKAGSGNPKLDKKSLKKKYHRYVKLYHPDHSDNIQIFSSEKVTNSDSKSPLLLTS SEKLHRFKVISQAYDILCDPKKKIVYDTTRQGWTTSYSPRSNVNTENYQYAGSYGYHSNA QYEYWNAGTWEDANSMKNERIQENINPWTVIGIICGLAICIEGTALLAKIQESLSKAEFT HDESGLHLIQSYTNYGLDTDKFSRLRRFLWFRTWGLYKSKEDLDREAKINEEMIRKLKAA K |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | JID1 |
Synonyms | JID1; YPR061C; J domain-containing protein 1 |
UniProt ID | Q12350 |
◆ Recombinant Proteins | ||
RFL4208MF | Recombinant Full Length Mouse Potassium Voltage-Gated Channel Subfamily A Member 3(Kcna3) Protein, His-Tagged | +Inquiry |
PRSS8-1994H | Recombinant Human PRSS8, His-tagged | +Inquiry |
HNRNPD-4260M | Recombinant Mouse HNRNPD Protein, His (Fc)-Avi-tagged | +Inquiry |
C10orf96-454H | Recombinant Human C10orf96 Protein, GST-tagged | +Inquiry |
SIX3-8187M | Recombinant Mouse SIX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen-316B | Native Bovine Collagen Type II | +Inquiry |
PLD-19S | Active Native Streptomyces sp. Phospholipase D, Type VII | +Inquiry |
IgG-007G | Native Goat Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
THBS1-31514TH | Native Human THBS1 | +Inquiry |
Lectin-1848S | Active Native Soybean Agglutinin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HERPUD2-5583HCL | Recombinant Human HERPUD2 293 Cell Lysate | +Inquiry |
EIF2AK3-6673HCL | Recombinant Human EIF2AK3 293 Cell Lysate | +Inquiry |
Stomach-481P | Porcine Stomach Lysate | +Inquiry |
Breast-57H | Human Breast Membrane Lysate | +Inquiry |
PLIN3-3106HCL | Recombinant Human PLIN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All JID1 Products
Required fields are marked with *
My Review for All JID1 Products
Required fields are marked with *
0
Inquiry Basket