Recombinant Full Length Saccharomyces Cerevisiae Inner Nuclear Membrane Protein Heh2(Heh2) Protein, His-Tagged
Cat.No. : | RFL7367SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Inner nuclear membrane protein HEH2(HEH2) Protein (Q03281) (1-663aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-663) |
Form : | Lyophilized powder |
AA Sequence : | MDHRNLDPKTLKVSQLRRVLVENDVAFPANARKPVLVKLFEEKVRQRLQSSPEASKVRTS IQKVVKSGAKNADRKKTLKSKKLESSSSESKTVKDENVETNKRKREQISTDNEAKMQIQE EKSPKKKRKKRSSKANKPPESPPQSKSDGKATSADLTSELETVEELHKKDSSDDKPRVKE LPKPELPNLKVSNEFLAQLNKELASAATENYDHSIKSTDLSSIRIETEEPVGPSTGAETR NESEVMENINLEVQPEVKEAKEELTKISETFDNQDEEDTSRLSSKKNIRSPKGRTRHFIA NKTKRGIDIMKPFIAHLFIWLWNGAIFLSIICPILFGLWYREQRIQVGYCGHEKPLKSLA ISAFPQTERVDSVLQAYRPNCLECPEHGICSSFMNVECEPGYEPKSSILETYGIIPFPKY CAKDESKEKEVDELVWKVNEYLKKKNAQHECGEGENLFESGETETKLYDIFSHSRPSWES QREFNDHWKNVLEILKKKDDIIWLPLDFETNGKREKSKSNNTNYIYRSTSKKWVTLQCHL EGDIQEYITKYGGSLFITLGVLFLIKKIQSTLDNYVQGEQIIEKLVKEAIDKLKDVKKNK GEEPFLTTVQLRATLLSDIPNIKEQNNLWAQTKEKIMKEQSENIELYLLEENGEIMTCWE WKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HEH2 |
Synonyms | HEH2; YDR458C; D8035.2; Inner nuclear membrane protein HEH2; Helix-extension-helix domain-containing protein 2 |
UniProt ID | Q03281 |
◆ Recombinant Proteins | ||
HMPREF0798-RS00260-1380S | Recombinant Staphylococcus hominis subsp. hominis C80 HMPREF0798_RS00260 protein, His-tagged | +Inquiry |
Lrp8-1339M | Recombinant Mouse Lrp8 Protein, MYC/DDK-tagged | +Inquiry |
RFL1368BF | Recombinant Full Length Bacillus Halodurans Protease Prsw(Prsw) Protein, His-Tagged | +Inquiry |
SCO5557A-1432S | Recombinant Streptomyces coelicolor A3(2) SCO5557A protein, His-tagged | +Inquiry |
FAM212A-3737H | Recombinant Human FAM212A Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
GGT1-8130H | Native Human Liver Gamma-Glutamyltransferase | +Inquiry |
Lectin-1731R | Active Native Ricinus Communis Agglutinin I Protein, Rhodamine labeled | +Inquiry |
GPT-5344H | Native Human Glutamic-Pyruvate Transaminase (alanine aminotransferase) | +Inquiry |
APCS-8258H | Native Human Serum Amyloid P | +Inquiry |
APOH-4217H | Native Human APOH protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SDS-2004HCL | Recombinant Human SDS 293 Cell Lysate | +Inquiry |
Thyroid-449S | Sheep Thyroid Lysate, Total Protein | +Inquiry |
MRPL15-4194HCL | Recombinant Human MRPL15 293 Cell Lysate | +Inquiry |
STX6-1373HCL | Recombinant Human STX6 293 Cell Lysate | +Inquiry |
FAM101A-251HCL | Recombinant Human FAM101A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HEH2 Products
Required fields are marked with *
My Review for All HEH2 Products
Required fields are marked with *
0
Inquiry Basket