Recombinant Full Length Saccharomyces Cerevisiae High Osmolarity Signaling Protein Sho1(Sho1) Protein, His-Tagged
Cat.No. : | RFL923SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae High osmolarity signaling protein SHO1(SHO1) Protein (E7KBW4) (1-367aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-367) |
Form : | Lyophilized powder |
AA Sequence : | MSISSKIRPTPRKPSRMATDHSFKMKNFYADPFAISSISLAIVSWVIAIGGSISSASTNE SFPRFTWWGIVYQFLIICSLMLFYCFDLVDHYRIFITTSIAVAFVYNTNSATNLVYADGP KKAAASAGVILLSIINLIWILYYGGDNASPTNRWIDSFSIKGIRPSPLENSLHRARRRGN RNTTPYQNNVYNDAIRDSGYATQFDGYPQQQPSHTNYVSSTALAGFENTQPNTSEAVNLH LNTLQQRINSASNAKETNDNSNNQTNTNIGNTFDTDFSNGNTETTMGDTLGLYSDIGDDN FIYKAKALYPYDADDDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQLID GPEEMHR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SHO1 |
Synonyms | SHO1; SSU81; AWRI796_1396; High osmolarity signaling protein SHO1; Osmosensor SHO1; Suppressor of SUA8-1 mutation; Synthetic high osmolarity-sensitive protein 1 |
UniProt ID | E7KBW4 |
◆ Recombinant Proteins | ||
SOUL-6352C | Recombinant Chicken SOUL | +Inquiry |
RGL2-3684R | Recombinant Rhesus Macaque RGL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
B117L-0659A | Recombinant ASFV B117L Protein (Met1-Gln115), N-His-tagged | +Inquiry |
S100A4-6215H | Recombinant Human S100A4 Protein (Met1-Lys101), N-His tagged | +Inquiry |
RAB6A-0909H | Recombinant Human RAB6A Protein (M1-C208), Tag Free | +Inquiry |
◆ Native Proteins | ||
SV40gp6-268 | Active Native Simian virus 40 SV40gp6 protein | +Inquiry |
Lectin-1753A | Active Native Aleuria Aurantia Lectin Protein, Fluorescein labeled | +Inquiry |
Complement C3b-47H | Native Human Complement C3b | +Inquiry |
LTF-3211B | Native Bovine Lactoferrin Protein | +Inquiry |
Collagen-56B | Native Bovine Collagen Type II | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPB41L4A-563HCL | Recombinant Human EPB41L4A cell lysate | +Inquiry |
RHOF-1505HCL | Recombinant Human RHOF cell lysate | +Inquiry |
Diaphragm-512D | Dog Diaphragm Lysate, Total Protein | +Inquiry |
FBXL4-600HCL | Recombinant Human FBXL4 cell lysate | +Inquiry |
TGIF2LX-1112HCL | Recombinant Human TGIF2LX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SHO1 Products
Required fields are marked with *
My Review for All SHO1 Products
Required fields are marked with *
0
Inquiry Basket