Recombinant Full Length Saccharomyces Cerevisiae High Osmolarity Signaling Protein Sho1(Sho1) Protein, His-Tagged
Cat.No. : | RFL4160SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae High osmolarity signaling protein SHO1(SHO1) Protein (E7QE10) (1-367aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-367) |
Form : | Lyophilized powder |
AA Sequence : | MSISSKIRPTPRKPSRMATDHSFKMKNFYADPFAISSISLAIVSWVIAIGGSISSASTNE SFPRFTWWGIVYQFLIICSLMLFYCFDLVDHYRIFITTSIAVAFVYNTNSATNLVYADGP KKAAASAGVILLSIINLIWILYYGGDNASPTNRWIDSFSIKGIRPSPLENSLHRARRRGN RNTTPYQNNVYNDAIRDSGYATQFDGYPQQQPSHTNYVSSTALAGFENTQPNTSEAVNLH LNTLQQRINSASNAKETNDNSNNQTNTNIGNTFDTDFSNGNTETTMGDTLGLYSDIGDDN FIYKAKALYPYDADDDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQLID GPEEMHR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SHO1 |
Synonyms | SHO1; SSU81; VL3_1387; High osmolarity signaling protein SHO1; Osmosensor SHO1; Suppressor of SUA8-1 mutation; Synthetic high osmolarity-sensitive protein 1 |
UniProt ID | E7QE10 |
◆ Recombinant Proteins | ||
HERPUD2-4698H | Recombinant Human HERPUD2 Protein, GST-tagged | +Inquiry |
PTK7-7266M | Recombinant Mouse PTK7 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB7A-4557R | Recombinant Rat RAB7A Protein, His (Fc)-Avi-tagged | +Inquiry |
SERPING1-924H | Recombinant Human SERPING1 Protein, His-tagged | +Inquiry |
MGST2-6523HF | Recombinant Full Length Human MGST2 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Proc-5346M | Native Mouse Protein C | +Inquiry |
GPDH-119R | Active Native Rabbit Glycerol-3-phosphate Dehydrogenase | +Inquiry |
MMP9-29698TH | Native Human MMP9 | +Inquiry |
DNA-005C | Native Calf DNA | +Inquiry |
SERPINA3-5331H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF498-2039HCL | Recombinant Human ZNF498 cell lysate | +Inquiry |
BIRC5-8449HCL | Recombinant Human BIRC5 293 Cell Lysate | +Inquiry |
DNAJA4-492HCL | Recombinant Human DNAJA4 cell lysate | +Inquiry |
TIMELESS-1074HCL | Recombinant Human TIMELESS 293 Cell Lysate | +Inquiry |
GRAMD1B-309HCL | Recombinant Human GRAMD1B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SHO1 Products
Required fields are marked with *
My Review for All SHO1 Products
Required fields are marked with *
0
Inquiry Basket