Recombinant Full Length Saccharomyces Cerevisiae Golgi To Er Traffic Protein 1(Get1) Protein, His-Tagged
Cat.No. : | RFL12490SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Golgi to ER traffic protein 1(GET1) Protein (B5VIU1) (1-235aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-235) |
Form : | Lyophilized powder |
AA Sequence : | MHWAAAVAIFFIVVTKFLQYTNKYHEKWISKFAPGNELSKKYLAKVKERHELKEFNNSIS AQDNYAKWTKNNRKLDSLDKEINNLKDEIQSENKAFQAHLHKLRLLALTVPFFVFKIMYG KTPVYKLSSSTSTLFPTFVSGVWSQGWLYVLLHPLRTISQKWHIMEGKFGASKFDDMALQ SVSLGIWVWALMNVINGVEFIVKQLFLTPKMEAPASVETQEEKALDAVDDAIILD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GET1 |
Synonyms | GET1; AWRI1631_72180; Golgi to ER traffic protein 1; Guided entry of tail-anchored proteins 1 |
UniProt ID | B5VIU1 |
◆ Recombinant Proteins | ||
KDR-240H | Recombinant Human KDR, C13&N15-labeled | +Inquiry |
RFL16123SF | Recombinant Full Length Synechococcus Elongatus Photosystem Ii 44 Kda Reaction Center Protein(Psbc) Protein, His-Tagged | +Inquiry |
NPB-2894R | Recombinant Rhesus Macaque NPB Protein, His (Fc)-Avi-tagged | +Inquiry |
SCO3668-478S | Recombinant Streptomyces coelicolor A3(2) SCO3668 protein, His-tagged | +Inquiry |
FAM162A-5499Z | Recombinant Zebrafish FAM162A | +Inquiry |
◆ Native Proteins | ||
Actin-340R | Native Rabbit Actin Protein | +Inquiry |
ACTC1-5294H | Native Human Actin, Alpha, Cardiac Muscle 1 | +Inquiry |
COL1A1-23M | Native Mouse Collagen I Protein | +Inquiry |
Apotransferrin-39H | Native Human Apotransferrin | +Inquiry |
Factor D-61H | Native Human Factor D | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFIT1-5288HCL | Recombinant Human IFIT1 293 Cell Lysate | +Inquiry |
CTIF-903HCL | Recombinant Human CTIF cell lysate | +Inquiry |
AQP8-34HCL | Recombinant Human AQP8 lysate | +Inquiry |
EBPL-6732HCL | Recombinant Human EBPL 293 Cell Lysate | +Inquiry |
LEPRE1-4772HCL | Recombinant Human LEPRE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GET1 Products
Required fields are marked with *
My Review for All GET1 Products
Required fields are marked with *
0
Inquiry Basket